KEGG   Falco peregrinus (peregrine falcon): 101921531Help
Entry
101921531         CDS       T02856                                 

Gene name
LCT
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00052  Galactose metabolism
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101921531 (LCT)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     101921531 (LCT)
    3.2.1.108  lactase
     101921531 (LCT)
Chaperones and folding catalysts [BR:fpg03110]
 Intramolecular chaperones
  Others
   101921531 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 101921531
NCBI-ProteinID: XP_013158661
LinkDB All DBs
Position
Un
AA seq 1926 aa AA seqDB search
MEPVCKTVIFFLLVSPSLGIEGEFAQNFITIAGPLPSELVTRLYLHDQVLSEEDQGPAVA
EARDYLCQQDLVASELPQYFSHLREIGVTHYKIFLPWARVLPEGNARKPAEAQVRCYQEL
LKTLIAAGLRPVAVLHHQRVPGTVAVQAVGGKANAVADLFVEYAEFSFRVFGDLVDVWLS
FSDLPEVLKSLPYDDPQDQAQALAAAHERAYTVYHEKYAPVGGKLSIALGMDHVLDSALS
ELLSNSIQNSVDFLSLSLQYYCRNETDFYRKLNEFQNVWKDVEILVFSLKFLDCGSTEDN
PFIPVAAIVTAINKEETRTIGYDVNEFLDFSSSQVLSKTNTLQENPDAILAPRSSYQTVW
ETFAQQSEWERDSLLQDVFPGGFLWGISTGAFNIEGAWAEDGKGESIWDHFGHAGHVYMN
QTADMACDSYYKTSYDVYLLRGLHPQLYKFSVSWPRIFPAGTTETVNSKGVDYYNQLINR
LLESNIEPMVTLFHWDLPQALQVLGGWQNDSIIDAFVNYADFCFSTFGDRVKLWITFHEP
WVISYAGYGTGEHPPGIIDPGVASYKVAHTILKAHAKVWHLYNDKYRSQQLGKVGLVLNS
DWAEPKTPTNPEDVRASERYLQFMLGWFAHPVFVNGDYPDILKARIQEVNQQCSTTVAQL
PLFTEQEKSWVKGTADFFGLSHYTSYLVSAMTNGTCTPGYESIGNFSLHVDPSWPQTASS
WIHVVPWGLRRLLKFVSQEYTGTKIPIYIAGNGMPTEDGGDLINDTVRVDYFHRYINEAL
KAVKLDTVDVRSYVARSLVDGFEGPAGYSLKFGLHHVDFGDGNRPRTPRASAYFYSSVIE
KNGFPPEVLDRFSTPVVFDLPVPSKLPSLPASEVPSKAKVVWQKFSSQTDFERDMYFYAT
FPEDFTWGVSSSAYQVEGGWNADGKGPSIWDNFTHVPGNIKNNDNGDVACDSYNKVEEDI
YLLRALGVKNYGFSLSWSRIFPSGRNNSINIHGVDYYNRLIDGLVANNITPIVTLYHWDL
PQALQDIGGWESSVLIDLFDSFADFCFQTFGDRVKFWITFNEPQVIAWAGYGTGTFPPNV
NDPGSAPYRVAHILLKAHARVYHTYDDKYRASQGGVIALCPNIDWVEPKTPSDPRHVEAA
DRYLQFLVGWFTHPIFKNGDYPEVMKWKVGNRSELQDLPSSRLPVFTAEEREYIRGTADV
FCFNTYTSKIVTHATTRLKPFSYEYDQEVSAKTDSSWPPSAITDHRAVAWGMRRLLNWIK
EEYGNPPIYIIKNGVGIKTKSDVDDNTRIFYYKTYIDEALKAYKLDGVNLKGYNAWSFMD
SFEWLNGYEPRFGLHQVDFDNPNRPRTPKRSAVYYAEIIRNNGIPLPKEDEFLYGEFPEN
FRWSVATAAYQIEGGWRADGKGLSIWDRYAHTPLKIGNDDTGDVACDSYHKIEEDVEMLK
SLKVSHYRFSISWSRVLPDGTTRYINEMGLNYYERLIDALLAANIMPQVTLYHWDLPQAL
QNVGGWENDTIVQRFKEYAELLFQRLGDKVKFWITLNEPYNTAYLGYGVGTAAPGVSIRP
GRAPYVVGHNLIKAHAEAWHLYNETYRAKQGGLISITINSDWAEPRNSHKQEDVDAVRQF
LQFFLGWFAHPIFKNGDYNEVMKKRIRERSLAQGLNQSRLPEFTESEKQRIKGTYDYFGL
NHYTTILTYKINYPTGVQSYDSDRGVATVTDRSWLGSGSVWLKVTPFGFRKILRWIKEEY
NNPPIYVTENGISERGAFRFNDTWRTHYLRSYINEALKAVVLDGVDLRGYTVWTLMDNFE
WAVGFDEKFGFYHVNFTDPNLPRRPKASARFYSQIINCNGFPDPATGPHPCLEVEPEAAP
TDITPGPAASVRFLGLDLTSQNAEIALYVLFALSGVGALGLALFAYLYAKSSRQSPKQPH
MKLSKL
NT seq 5781 nt NT seq  +upstreamnt  +downstreamnt
atggagccagtttgtaagacagtcatcttctttctgttagtttctcccagtcttgggata
gagggggaatttgctcagaattttatcaccattgctggacctctacccagcgagctagtg
actagattgtatctgcatgaccaagtcctctctgaggaagatcagggccctgccgtggct
gaagcccgtgattacctgtgccaacaagatcttgtggcttctgaactgccccagtacttc
tcccaccttcgtgagattggagtgacacattacaagatcttcctgccgtgggcacgcgtt
cttccagaagggaatgccaggaagccggctgaagctcaagtgcggtgctaccaggagctg
ctcaagaccctgattgctgcaggcctcaggccagtggcagttctgcatcaccagcgtgtc
cctggcaccgtggctgtgcaggctgtgggtgggaaagccaacgctgttgctgaccttttt
gtggaatacgcagagttcagcttccgtgtttttggagacctggtcgatgtgtggctcagc
ttcagtgacctaccggaggtccttaaaagcctgccttatgatgacccccaggaccaagcc
caggccctggctgctgctcatgaaagagcttacactgtctaccatgagaaatacgcacca
gtgggtggaaagctgtccattgctttaggaatggatcatgtcttggatagtgccttatca
gaattgctttcaaattcaattcagaattcggtagattttctgtctctcagccttcagtac
tattgcagaaatgaaacggatttctacaggaagttgaatgaattccagaatgtctggaag
gacgtagagatcttggtttttagtctgaagttccttgattgtggttccacggaagacaat
cccttcataccagtagctgccattgtcacagctattaataaagaagagacacgtacaatt
gggtatgatgttaacgagttcttggacttctcatcatctcaagttttaagcaaaacaaat
actctacaagagaacccagatgccattcttgcccctcgctcgtcctatcagacagtttgg
gaaacgtttgctcaacagtctgaatgggagagagattctcttctgcaagatgttttccca
ggtggcttcctctggggcatatccacaggtgccttcaacatcgaaggagcttgggcagag
gatgggaaaggagagagcatctgggaccactttggacacgcaggccatgtctacatgaac
caaacagcagacatggcatgtgacagctactataaaaccagctatgacgtttacctgctt
aggggtcttcatccccaattgtacaaattttctgtatcctggcctagaattttccctgct
ggcaccaccgagactgtcaactccaagggtgttgattattacaaccaattaattaatcgg
ttgctagagtctaacattgagcccatggtgactctgttccactgggacctcccacaagct
cttcaggttcttggtggctggcagaatgacagtattatagatgcttttgtaaactatgcc
gacttctgcttttccacttttggggatcgagtcaagctctggattactttccatgagcct
tgggttatcagctacgctggctatggcaccggagagcatcctccaggaatcattgaccca
ggagtagcatcttacaaggtggctcacacaattctcaaggctcatgccaaagtctggcac
ctgtataatgacaaataccgttctcagcaactgggaaaggtggggctggttctgaactcg
gattgggctgaacccaagactccaaccaaccctgaggacgtgagggcatctgagaggtac
ctgcagttcatgcttggctggtttgctcaccctgtatttgttaatggggattacccagat
atcctgaaggctcggatccaggaagtaaaccagcagtgctccacaacagttgcacagctg
cctctgtttacagagcaggagaagtcctgggtgaaagggactgcagatttttttggtctt
tcccattacacttcctacctggtcagtgctatgactaatgggacctgcacaccaggctac
gagagcatcgggaacttctccttgcatgtagatccttcttggccacagactgcctcttct
tggatccatgtggtcccttggggattaagaaggctgctgaagtttgtgtcccaggaatat
acagggacaaagatcccaatttacatagcaggaaatggtatgccaacggaagatggaggg
gatcttattaatgacactgtgcgagtggattatttccaccggtacatcaatgaagctcta
aaagcggtgaaactagacacagttgatgttcggtcatacgtggctcgatccctggttgat
ggctttgaaggcccggcagggtacagcctaaaatttgggctgcatcatgtggattttgga
gatggcaatagaccaaggactcccagggcatctgcttatttctattccagcgttattgaa
aaaaatggtttcccacctgaagtcttggacagattttctaccccagtggtgtttgaccta
cctgtgccatcaaagctgcccagtttaccagcatcagaagttccctccaaggcaaaagtc
gtctggcagaagttttcatcccaaacagattttgaaagggacatgtacttttatgcgaca
ttcccagaggactttacatggggtgtgtcgtcttctgcctaccaggtagagggaggttgg
aatgctgatggcaaaggacccagcatttgggataacttcacccatgtcccagggaatata
aagaataatgataatggagatgtagcttgtgatagctacaacaaggtggaggaggatatt
tacctgctgagagccttaggggtaaagaactatggtttctctctgtcctggtctcgaatt
ttccccagtggaaggaacaactcaataaacatccatggagttgactactataaccgcctc
attgatggactggttgcaaacaacatcactcctatcgtcactctctaccactgggacctg
ccacaagctctccaggacattggtggctgggagagcagcgtgctgatcgacctgtttgat
agttttgcggatttctgtttccagacctttggtgacagggtgaagttctggattacgttc
aatgaaccccaagtcattgcctgggcaggctatggcactgggacatttccacccaacgtc
aatgaccctggcagtgctccctacagggttgcccacatcttactgaaagctcatgccagg
gtctaccacacgtacgatgacaagtacagagcgagtcaaggaggagtcattgccctgtgt
cccaacattgactgggttgagccaaagacaccaagcgaccccaggcacgtagaagctgca
gacaggtacctgcagtttttggtggggtggtttacacacccgattttcaaaaacggggac
taccctgaggttatgaagtggaaagttgggaacaggagtgagcttcaggacctgccatcg
tctcgcctaccagttttcacagcggaggagcgtgaatacatcaggggcacggcagatgtt
ttctgcttcaacacctacacctccaaaattgtaacccatgcaacaacccggttgaagccc
ttctcttacgagtatgaccaggaagtttcagcaaagactgacagctcctggcctccctca
gctattactgaccatcgggctgtggcctggggcatgaggaggctactgaactggatcaaa
gaagaatatggaaatcccccaatatacatcattaagaacggggtggggataaagaccaaa
tcggatgttgatgacaataccaggattttttactacaaaacatacattgatgaagcttta
aaagcttacaaattggatggtgttaatctgaaaggatacaatgcttggtcttttatggat
agctttgaatggttgaatggttatgagccaagatttggattgcaccaggttgattttgac
aatcccaacaggcccagaaccccaaagcgctctgctgtgtactatgcagaaatcatccgc
aataatggtatcccattgccaaaagaagatgaatttttatatggagagtttccagagaac
tttcggtggagtgtagcgactgcagcatatcagattgagggaggatggagagccgatggg
aaaggacttagcatttgggaccgatatgctcacacccccttgaaaatcggcaatgatgac
actggagatgtagcttgtgacagctaccacaagattgaggaggatgtggaaatgctgaaa
agcctcaaggtgtctcactatcgcttttcaatctcctggtcccgtgttctcccagatgga
accaccagatacatcaatgaaatgggactgaactactatgaaaggcttattgatgctctt
ctggcagctaacattatgcctcaggtaactctctatcattgggacctcccacaggcactg
cagaatgtcggtgggtgggagaatgatactatagttcagaggtttaaggaatatgctgag
ctccttttccagaggctgggagataaagtgaaattttggataaccctcaatgaaccctac
aacactgcatatttgggctatggcgttggcacagccgctccaggcgtctccattcggcca
gggcgagccccctacgtggtggggcacaacttaataaaggcccatgcggaagcctggcac
ctctacaatgagacctaccgggcaaaacaaggaggattaatctcgatcaccatcaactct
gactgggcagaaccaaggaactcccacaaacaggaggatgttgatgctgtcagacaattt
ttgcagttttttctaggttggtttgctcatcccattttcaaaaatggtgactataatgaa
gtgatgaaaaagaggattcgggaacgcagtctggctcagggtctgaaccagtcccgactt
ccagaatttactgaaagtgaaaagcaaagaattaaaggcacatatgactactttggccta
aatcattatactacaattttaacatacaaaataaactatcctactggtgttcagtcatat
gactctgacaggggtgtagctactgtaactgaccgcagctggctgggttctggttctgtc
tggctaaaggtgacaccctttggtttccgaaaaatcctgagatggataaaagaagagtac
aacaaccctcccatttacgtcactgaaaatgggatctcagaaagaggagccttccgcttc
aatgacacttggcgaacacattacctccggagctacattaacgaagcactgaaagctgtg
gtgctcgacggtgtcgacttaagaggctacactgtatggacgctgatggacaactttgag
tgggcagtgggctttgatgagaagtttgggttctatcacgtgaatttcacagaccccaac
ctgccgcgccgccccaaggcttctgccaggttttactcacagatcataaactgcaacggg
tttccagacccagcaacaggcccgcatccctgtctggaagtggagcctgaagcggcaccc
acagacatcacaccaggaccagctgccagcgtgcgctttttgggattagatttaacatca
caaaatgcagaaatagcactgtacgtgctttttgctctgtcaggagtaggagcattgggc
ttagctctttttgcatacctgtatgcaaaatcatccagacaatcccctaaacaaccacac
atgaaacttagtaaactgtaa

DBGET integrated database retrieval system