KEGG   Falco peregrinus (peregrine falcon): 101921567
Entry
101921567         CDS       T02856                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00230  Purine metabolism
fpg01100  Metabolic pathways
fpg04020  Calcium signaling pathway
fpg04114  Oocyte meiosis
fpg04261  Adrenergic signaling in cardiomyocytes
fpg04270  Vascular smooth muscle contraction
fpg04371  Apelin signaling pathway
fpg04540  Gap junction
fpg04912  GnRH signaling pathway
fpg04914  Progesterone-mediated oocyte maturation
fpg04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101921567 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101921567 (ADCY3)
   04020 Calcium signaling pathway
    101921567 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101921567 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101921567 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101921567 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    101921567 (ADCY3)
   04916 Melanogenesis
    101921567 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101921567 (ADCY3)
   04270 Vascular smooth muscle contraction
    101921567 (ADCY3)
Enzymes [BR:fpg01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101921567 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4
Other DBs
NCBI-GeneID: 101921567
NCBI-ProteinID: XP_005236727
LinkDB
Position
Un
AA seq 1136 aa
MPRNRAFSEPECSAEYSADYSVSLPSDPERGVGRTHEVTVRSSGPCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVLVMCAVVYTADKLAPLLAAAAGLVAHVL
LFILCKYRLLPERVARRFLPYILWVLILAQIFCYLGLNFSRSPEASDTVGWQAFFVFSFF
ITLPLRLAPIVLITAISCGIHTLVLGVTIAQQRQDALDEGTLLRQILSNVAIYLCAITVG
TMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPEYREDHAVCSIMMGLAMVEAISYVREKTKTAVERRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGEGGSRCE
YLKEKGIITYLVVVPKQPLRNGINGVKLSLTSSHGGSPPLVNTKERNGSLSLACASPEEP
EEPDTRVRGTLESGEEDGEAVNPSFPNPRRRLRLRDLAERVIDASQNEQELNKLLNEALL
ERESVQALKGKSTFRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEVFIDP
WLVANYVTFIVGEILLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMAAIII
VTMADIVDMLSCWQDHGGTGNGTVGPLRPGGCGEQPKYYSYIALLALVATIMLVQVSHMV
KLTLMVLITGATGAVNIYAWEHIFDQYDRHPVPTIHPCLAACAGRSLLVPSKYSMTAMIF
IVMLSFYYFSRHVEKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGS
KKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQ
FRCITKIKTIGSTYMAASGVTPDANANGYTTKKETLSDKERWQHLADLADFALAMKVTLM
NINYQSFNNFMLRIGMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEE
THLILKEYGFRFVRRGAIYVKGKGELLTFFLKGREKQGSFVNGSSVTLPHQVVDSS
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgcccaggaacagggctttttccgagcccgagtgctcggccgagtactcggcagactac
tcggtgagcctgccgtcggaccccgagcgcggcgtgggtcgcacccacgaggtgacggtg
cgcagctcgggaccctgcctctgcctgccccgcttcatgcgcctcaccttcgctcccgag
tccctggagaacctctaccagacttacttccgccgccaacgccacgagaccctcctggtg
ctggtggtctttgccgccctcttcgactgctacgtcctcgtcatgtgcgccgtggtctac
accgccgacaagctggccccgctgctggcggcagcggccgggctggttgcccatgtgctg
ctcttcatcctttgcaagtacaggctgcttcccgagcgggtggcccgcaggttcctgccc
tacatcctctgggtcctcatcttggcccagatcttctgctacctgggtctcaacttctcc
cgctcgcccgaggccagcgacacggtgggctggcaggctttcttcgtcttctccttcttc
atcactttgccgctgcgcttggcgcccatcgtgctcatcaccgccatctcctgcggcatc
cacacgctggtgctcggtgtcaccatcgcccagcagcggcaggatgccctggacgagggg
acgctgctgagacagatcctgtccaatgttgccatctacctttgcgccatcacggtgggc
accatgtcctactacatggctgaccgcaagcaccgcaaagccttccttgaagcacgccag
tcccttgaggtcaagctcaacctggaggagcagagccagcagcaggagcggctgatgctc
tccatcctgcccaagcacgtggccgatgagatgctgaaggacatgaagaaggacccgagc
cagaaggagatgcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctcttcgcagacattgtgggcttcacccagctgtcctcgtcctgcagcgcccaggagctg
gtgaagctcctcaatgagctcttcgcccgcttcgacaagctggcagccaaataccaccag
ctgcgcatcaagatccttggtgactgctactactgcatctgcgggctgcccgagtaccgg
gaggaccacgccgtctgctccatcatgatggggctggccatggtggaggccatttcctac
gtgcgggagaagaccaagacggcggtggagaggcgggtgggggtgcacagtgggacagtg
ctggggggggtgctgggccagaagcgctggcagtatgacgtgtggtccaccgacgttacc
gtggccaacaagatggaggcaggcggcatccctgggcgggtgcacatctcgcagagcact
atggattgcctgaagggtgagttcgaggtggagccgggtgaaggtggctcacgctgcgag
tacctgaaggagaagggcatcatcacctacctcgtcgtggtccccaagcagcccctgcgc
aacggcatcaatggggtgaagctgtcgctgacctcatcccacggtggctccccgccgctg
gtcaacaccaaggagcgcaacggcagcctcagcctggcctgcgccagccccgaggagcct
gaggagcccgacaccagggtgaggggcaccctggagagcggggaggaggatggagaggcc
gtgaacccctccttccccaaccctcggcggcggctgcgattgcgggacctggccgagcgc
gtgatcgatgcctcgcagaacgagcaggagctcaacaagctgctcaatgaagccttgctg
gagcgcgagtccgtgcaggcgctgaaggggaagagcaccttccgactctccatgcgcttc
attgaccccgagatggagacgcgctactcggtggagaaggagaagcagagcggagccgcc
ttcagctgctcctgcgttgtcctcttcttcactgctttggtagaggtcttcattgacccc
tggttggtggccaactacgtgactttcatagtcggggagatcctcctgctcatcctcacc
ctctgctcgttggctgccatcttcccccgggttttccctaaaaagctcgtggccttctcc
acctggattgacaggacccgctgggcacgcaacacctgggccatggccgccatcatcatc
gtcaccatggctgacatagtggacatgctcagctgctggcaggaccatggcgggacaggc
aacgggacggtggggccactgcggccaggcggctgtggggagcaacccaagtactacagc
tacattgccctgctggccttggtggccaccatcatgctggtgcaggtcagccacatggtc
aagctgaccctcatggtgctgatcactggggccaccggcgctgtcaacatctacgcctgg
gagcacatctttgaccagtatgaccgccaccccgtgcccaccatccacccatgccttgct
gcctgtgccggcaggtccttgctggtcccctccaaatactccatgacagcgatgatcttc
atcgtgatgctcagcttctactacttctctcgtcatgtggagaagctggccaggaccctt
ttcctctggaagattgatgtccatgaccagaaggagcgggtctatgagatgcggcgctgg
aatgaggctcttgtcaccaacatgctgcctgagcacgtggcccggcacttcctgggctcc
aagaagcgggacgaggagctgtacagccagtcctatgatgagattggtgtcatgtttgcc
tccctccccaactttgccgacttctacacagaggagagcatcaacaacgggggcattgag
tgcctgcgcttcctcaacgagataatctccgacttcgacgcgctcctggacgaaccccag
ttccgctgcatcaccaaaatcaagaccatcggcagcacctacatggcggcttctggagtg
acccctgatgccaatgccaacggctacaccaccaagaaggagaccctctcggataaggag
cgctggcagcacttggccgacctggccgactttgccttagccatgaaggtgacactgatg
aacatcaactaccagtccttcaacaacttcatgctccgcataggcatgaacaagggggcc
gtgctggcaggtgtcattggtgcccgcaagccacactacgacatctggggcaacacggtc
aacgtggccagcaggatggagtccaccggcgtgatggggaacatacaggtggtggaggag
acccacctcatcctgaaggagtacggcttccgctttgttcgccggggagccatctacgtc
aaaggcaaaggggagctgctcaccttcttcctcaagggccgggagaagcagggctccttt
gtcaatggctcctccgtcaccctgccccaccaggtggtggacagctcctga

DBGET integrated database retrieval system