KEGG   Falco peregrinus (peregrine falcon): 101921612Help
Entry
101921612         CDS       T02856                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101921612 (CACNA1E)
   04020 Calcium signaling pathway
    101921612 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fpg04040]
    101921612 (CACNA1E)
Ion channels [BR:fpg04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101921612 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DUF3141
Motif
Other DBs
NCBI-GeneID: 101921612
NCBI-ProteinID: XP_005231695
LinkDB All DBs
Position
Un
AA seq 2287 aa AA seqDB search
MARFGEAVAGRLGSGAGGSDQNRSRQGPPAPAGGTPGAFKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFLFGEENIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLNRRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRN
RTDAMNRDSSDEHCVDISSVGNPLSHSGLKGARVDGASYLRHKERLLRISVRHMVKSQVF
YWIVLSLVALNTACVAIVHHNQPAWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHS
SFNCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMS
SMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFIDGTPSANFDTFPAAIMTVFQILTGED
WNEVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQE
EEEAFNQKHALQKAKEVSPMSAPNMPAIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVW
EQRTSQLRRHMQMSSQEGINKDEPPLINPHASIFRRKKPGDGVALEKCTEEQGGKGERPP
AEGPEQPAPGANPGGGEDRRSPSPRAKRDKEPWHQKSCHGNCEPGEQDGAGGSIEDRARM
RQSQRRSRHRRARMEGKEPAGALGSRSASQEMGLEEASPTEGMQDGDRRGDLAAAEALIQ
GEPEASGESIRTNGVPAGNAELVGTAEEGSAQRGGPEPPQGKTGSLMEQDCSSLDTSEQA
LLEASHTVSRSEPDLSSITPNTEKATESTTIMIDVHDSTVVQISNKTDGEASPLKEAESK
EDEEEMEKKKRKKEKSETGKAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAA
SSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNIL
DFIVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTS
LKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKC
REWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVV
YFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRH
TFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLEC
VLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIK
LLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIRLDEESHINRHNN
FRSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVS
FIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMY
EMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGG
ADWQQLDSELQKEILTIWPHLSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKK
QRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLSGLSSRSGFPSLSPLSPQE
IFQLACMDPAHGQFQEHQSLEPEVREFQRVQPSNRGSYLPVDTQDHAVSGRASSMPRLTV
DPQVVTDTSSMRRSFSTIRDKRTNSSWLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLN
TDSGHRSDGHRSGGRERGRSKERKHLLSPDISRCNSEERSPQAHDESPERRRESRSPSEG
RSQTPNRQGMGSLSESSIPSISDTSTPRRGRRQLPPVPPKPRPLLSYASMLRHAGDASPP
ADESEGGSPLLSSTLEPNAAGLTESSSSPAGKQSRQSTPQRYISEPYLALHDDSHASDCG
EEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGAGQGMMCGASIDVLSD
TEEDDKC
NT seq 6864 nt NT seq  +upstreamnt  +downstreamnt
atggctcgttttggggaggcggtggccggcaggctgggctccggagccgggggctccgac
cagaaccggagccggcaaggaccccctgcccctgcaggagggaccccgggagccttcaag
caaaccaaagcgcagagagcccggactatggctctgtacaaccccatacctgtccggcag
aactgcttcaccgtcaacagatcactcttcctctttggggaagagaacatagtcaggaaa
tatgctaagaagctcatcgactggcctcccttcgaatacatgatcttggcgaccatcatt
gccaactgcattgtgctggcgctcgagcagcacctccctgaggatgacaagacgcccatg
tcacggagattagagaagacggagccctacttcatcgggattttctgctttgaggctggg
attaagattgtggctctggggtttgttttccacaagggctcatacctgcgcaatggctgg
aacgtcatggacttcatcgtggtcctcagtggcatccttgccaccgctgggacgcacttc
aacacccacgtggacctgcggacgctgcgggctgtgcgtgtgctcagacctctgaagctt
gtctcaggcattcccagcctgcagattgtgctgaaatccatcatgaaggccatggtgcct
ctcctccagattggcttgctgctcttttttgctatcctcatgtttgctattatcggcctg
gagttctacagcgggaagctgcaccgagcctgctatacaaacaattcaggtgaactagag
gagctggaccccccccatccatgcggggtgcagggttgccccccaggatacgaatgccgg
gagtggatcggtcccaacgatgggatcacgcagtttgacaacatcctctttgctgtgttg
actgtcttccagtgcatcaccatggaagggtggaccacagtcctgtacaataccaatgat
gccttaggagccacctggaactggctgtacttcatccctctcatcatcattggatccttc
tttgtcctcaaccttgtcctgggagtgctgtcgggggagtttgccaaagagcgtgagcgg
gtggagaaccgccgagccttcatgaagctgaaccggcggcgccagcagcagatcgagcgg
gagctcaacggctaccgagcctggatagacaaagcagaggaagtcatgctagctgaagag
aacaaaaattctgggacctcagccttagaagtgctcaggagagccaccatcaaaaggaac
cggacagatgccatgaaccgtgactcgagtgatgagcactgtgtcgatatctcctccgtg
ggtaaccccttgagtcactctggcctcaaaggcgccagagtggacggtgcctcctactta
cggcacaaggagcgactcctgcgcatctctgttcgccacatggtgaaatcccaggtcttc
tactggatcgtcttgagcctggtggctctcaacactgcctgtgtggccatcgtccatcat
aaccagccagcctggctcacccactttctctactatgcagagttcctgtttcttgggctc
ttcctcctggagatgtccttaaagatgtacgggatggggccacgcctttacttccattct
tccttcaactgctttgactgtggggtcacggtcggaagcatctttgaagtggtttgggct
atcttcagaccaggaacgtcttttgggatcagtgtcctacgagcccttcgtctcctgcga
atatttaaaataaccaagtactgggcatccctgaggaatttggtggtctcgctgatgagc
tccatgaagtctattatcagcctgctcttcctcctcttcctcttcattgtagtctttgcc
ctgctgggaatgcagctgtttggaggcaggtttaacttcatcgatgggacaccatcagcc
aactttgacactttccccgcggccatcatgacagtgttccagatcctgacgggtgaggac
tggaatgaggtgatgtacaacggcatccgctcccagggaggcgttcgctcgggcatgtgg
tcctccatctatttcatcgtcctcaccttgtttggaaactatactctgctgaatgtgttc
ttggccattgcggtggacaacctggccaacgctcaggagctcaccaaggatgagcaggag
gaagaggaggcctttaaccagaagcacgcccttcagaaagccaaagaagtcagccccatg
tctgccccaaacatgcctgctatcgaaagagacaggcgaaggagacaccacatgtcgatg
tgggagccacgcagcagccacctgcgggagcgtcgccggcggcaccacatgtcggtgtgg
gagcagcgcaccagccagctgcgccggcacatgcagatgtccagccaggagggcatcaac
aaggatgagccgcccctcatcaacccccatgccagcatcttccgcaggaagaaaccgggc
gatggcgttgccctggagaaatgcactgaggagcagggcggcaagggcgagcggccaccg
gctgagggacctgagcagccagccccgggagccaaccctggtggtggtgaggacaggagg
agcccatcaccccgggccaagcgagacaaggagccatggcaccagaaatcgtgccatggg
aactgtgagccaggcgagcaggatggggcaggaggcagcatcgaggatagggccaggatg
aggcaaagccagcggcgcagccggcaccgcagagcccggatggaggggaaggagccggct
ggtgccctggggagccgctcggccagccaggagatgggtctggaggaggccagccccacg
gaggggatgcaggatggggaccggcgtggggacttggctgcagcggaggcactgattcag
ggggagccagaggcgagcggagagtccatcaggacaaacggggtccctgccggcaatgca
gagctcgttgggaccgctgaggaggggagtgcccagcgagggggacctgagcccccccag
gggaagacaggcagcctgatggaacaggactgtagcagcctggacaccagtgagcaagca
ctgctagaggccagccacaccgtcagccggagcgagcccgacctctcctccatcaccccc
aacactgagaaggccacggagagcaccaccatcatgatcgatgtccacgactccactgtg
gtacagattagcaacaagacagatggcgaagccagccccttaaaggaggctgagagcaaa
gaggacgaggaggagatggagaagaagaagcggaagaaggaaaaaagtgagacgggcaaa
gcgatggtgccgcacagctccatgttcatcttcagcaccacaaacccggtgcggagggct
tgccactacattgtgaacctgcgttacttcgagatgtgcatcctcctggtgatcgccgcc
agcagcatcgcccttgcggcggaggatcccgtcctcaccaactccgaccgcaataaagtc
ctgaggtattttgactatgtcttcactggcgtcttcacctttgagatggttatcaagatg
attgatcagggcttgatcctgcaggatggctcctacttccgagacctctggaacatcctg
gattttatcgtggtggtgggagcgctggtggcctttgccttggcaaatgctttggggacc
aacaagggccgggatatcaagaccatcaagtctctccgtgtgctacgggtcctgaggccc
ctgaaaaccatcaagcgactgcccaagctgaaggctgtcttcgactgtgtcgtgacttcc
ctcaaaaatgtcttcaacatcctcatcgtctacaagctcttcatgttcatctttgctgtc
atcgccgtccagctcttcaaggggaagtttttctactgcactgacagctctaaggacacg
gagaaggactgcatagggaactacgtggaccatgagaagaacaagatggaggtgaagtgc
cgggaatggaaacgccatgagtttcactacgacaatatcatctgggctttgctcaccctg
ttcacagtctccaccggcgagggttggccccaggtgctgcagcattcggtggacgtaact
gaggaggaccgcggccctagccgcagcaaccgcatggagatgtccattttttatgtcgtc
tattttgtggtctttcctttcttctttgtcaacatttttgtggctctcatcatcattacg
ttccaagagcaaggagacaaaatgatggaggagtgcagtctggagaagaacgagagggcc
tgtatcgattttgccatcagtgccaagcccctcacgcggtacatgccccagaaccggcac
accttccagtaccgggtctggcactttgtggtctccccatccttcgagtacaccatcatg
gccatgatagcgttgaacaccgtggtgctgatgatgaagtactactctgctccatacacc
tacgagctggccctgaagtacctgaacatcgcgttcaccatggtgttctccttggagtgc
gtcctcaagatcatcgctttcggcttcctgaactatttccgggacacctggaacatcttt
gacttcatcaccgtcattggcagcattacggagatcatcctgacggacaccaagctggtg
aacaccagcagcttcaacatgagcttcctgaagctcttccgggctgctcgactcatcaaa
ttgctgcgccagggttacaccatccgtatcctgctctggaccttcgtgcagtccttcaag
gccctcccctatgtctgcctcttgatcgccatgctcttcttcatctacgcgatcattggg
atgcaggtttttggcaatatcagactagatgaggaaagccacattaaccggcacaacaac
ttccgcagctttttgggctccctcatgcttctcttcaggagtgccacaggagaggcatgg
caggagatcatgctgtcctgcctggagggcaaaggctgtgagcccgacacgacggcgacg
tctgggcagaacgagaatgagcgctgtggcactgacctggcctacgtttacttcgtctcc
ttcatcttcttctgctctttcctgatgctcaacctgtttgtggcagtcatcatggacaat
tttgaatacctgactcgggattcctccatcctgggacctcaccatctagatgagtttgtt
cggatctgggcagagtatgacagagcagcgtgtggccgaatccattacactgagatgtat
gaaatgctgactcttatgtcaccaccgctaggcctcggcaagagatgtccttccaaagtg
gcctataagagactggtgctgatgaacatgcccgtggccgaggacatgacggtccatttt
acctccaccttgatggcgctgatacgcacagccttggacatcaaaattgccaaaggtggt
gcagattggcagcagttagactctgaacttcaaaaggagatcctgaccatttggcctcac
ctgtcccagaagatgcttgacctgttggtacccatgccaaaaacctctgacctgactgtt
ggcaaaatatatgcagccatgatgatcatggattactacaagcagagcaaagcgaagaag
cagcggcagcagctggaggagcagaaaaatgcccccatgttccagcgcatggagccatcc
tccttgccgcaggaaatcatctcgaacgcgaaggctctgccttacctccagcaagacacc
ctctcgggcctgagcagccgaagtgggttcccctccctgagcccactctcaccacaggag
atcttccagctggcgtgcatggatccggcccacgggcagttccaggagcaccagtctttg
gagccagaggttagggagtttcaaagagtgcagccctctaaccgtggcagctaccttccc
gtggacactcaggaccatgctgtctctgggagggcctcctccatgcctcgtctcactgtg
gatccccaggtggtgacagacaccagctcgatgcgacgatcgttttccaccatccgggac
aagcgcaccaacagctcctggctggacgagttctccatggagcgcagcagcgacaacacc
tacaagtcccgccggcgcagctaccactcctcactccagctctccgcccggcgcctcaac
actgactcgggccaccggtccgacgggcatcgctcaggcggcagggagcggggccgatcc
aaagagcgcaagcacttgctgtcccccgatatctcccgctgcaactctgaagagaggagt
ccccaggcacacgacgagtcgccagagcggcggcgcgagtcccggtcacccagcgaaggc
aggtcccagacacccaacaggcagggaatgggctccctgagcgaaagctccatcccctcc
atctcggacaccagcaccccccggcgaggccgccgccagctcccgccggtgccccccaag
ccacggcccctcctttcctacgcctccatgctgcggcacgccggagatgcctcgccgccc
gccgatgagagcgagggggggtctccgcttctctcctccaccctggagcccaacgccgcc
ggcctgaccgagtcttccagctccccggcagggaagcagagccgacagtccaccccgcaa
cgctacatctcggagccctacctggccctgcacgacgactcgcatgcctcagactgcggt
gaggaggagacgctcactttcgaggctgccgtcgccaccagcctcggccgctccaacacc
atcggctcagccccgccgctgcggcacagctggcagatgcccaacgggcactaccggcgg
cggaggcgaggggcagggcagggcatgatgtgcggggccagcatcgatgtgctcagcgac
accgaggaagatgacaagtgctag

DBGET integrated database retrieval system