KEGG   Falco peregrinus (peregrine falcon): 101921728
Entry
101921728         CDS       T02856                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04115  p53 signaling pathway
fpg04140  Autophagy - animal
fpg04141  Protein processing in endoplasmic reticulum
fpg04210  Apoptosis
fpg04217  Necroptosis
fpg04261  Adrenergic signaling in cardiomyocytes
fpg04340  Hedgehog signaling pathway
fpg04510  Focal adhesion
fpg04621  NOD-like receptor signaling pathway
fpg05132  Salmonella infection
fpg05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101921728 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101921728 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101921728 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    101921728 (BCL2)
   04217 Necroptosis
    101921728 (BCL2)
   04115 p53 signaling pathway
    101921728 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101921728 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101921728 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101921728 (BCL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101921728 (BCL2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101921728 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fpg01009]
    101921728 (BCL2)
Protein phosphatases and associated proteins [BR:fpg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101921728 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 101921728
NCBI-ProteinID: XP_005234047
LinkDB
Position
Un
AA seq 236 aa
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPPAAAAAVAAAAGTSS
DHTGLVSPHPEPPGSAAASHVPPAEGLRPAPQVVHLALRQAGDEFSRRYQRDFAQMSGQL
HLTPFTARGRFVALFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIAAWMTEYLNR
HLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
NT seq 711 nt   +upstreamnt  +downstreamnt
atggctcatccggggagaagaggctacgataaccgggagatagtgctgaagtacatccac
tataaactctcgcagcggggatacgactgggctgccggcgaggacagggcacccctgcct
ccaggtctctctcctcctgctgctgctgctgcggttgctgctgctgctgggacttcctct
gatcacactgggctggtgtctccgcaccccgagccccccggctcggctgctgctagccac
gtgcccccggctgaggggctgcgccccgcaccccaggttgtccacctcgccctgcgccag
gcgggggacgagttctcccgccgctaccagagggactttgcccaaatgtctggccagttg
cacctgacgcccttcacggccaggggccgcttcgtggcgctcttccgagatggggttaac
tggggcaggattgtggccttcttcgagttcggcggcgtgatgtgcgtggagagtgtcaac
agggagatgtctcccctcgtagacagcatcgctgcctggatgaccgagtacctgaaccgg
cacctgcacaactggatccaggacaacggaggctgggatgccttcgtggagttgtatggc
aacagtatgaggcctttgtttgatttctcctggatctctctgaagactatcctgagtctg
gttctggtgggagcttgcatcactcttggcgcttatcttggacataagtag

DBGET integrated database retrieval system