KEGG   Falco peregrinus (peregrine falcon): 101921904
Entry
101921904         CDS       T02856                                 

Gene name
SMO
Definition
(RefSeq) smoothened, frizzled class receptor
  KO
K06226  smoothened
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101921904 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fpg04030]
    101921904 (SMO)
G protein-coupled receptors [BR:fpg04030]
 Frizzled / Smoothened family
  101921904 (SMO)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 101921904
NCBI-ProteinID: XP_005235379
LinkDB
Position
Un
AA seq 695 aa
MPKCEDGQVELPSQTLCQATRAPCTIVERERGWPDFLKCTPDRFPEGCPNEVQNIKFNSS
GQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEKEHREMHVYIAAFSSVTIFCTFFTLA
TFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARNEIVCRADGTMRLGEPTSNE
TLSCVIIFVIVYYSLMSGVIWFVMLTYAWHTSFKALGTTYQPLLGKTSYFHLITWSIPFV
LTVAILAVAQVDGDSVSGICFVGYKNYHYRAGFVLAPIGLVLIVGGYFLIRGTLTLTTSS
FHCRGYVSEKAASKINETMLRLGIFGFLAFGFVFITFGCHFYDFFNQAEWERSFREYVLC
EANVTIATQTNKPIPDCEIKNRPSLLVEKINLFAMFGTGVSMSTWVWTKATLLIWKRTWC
RLTGQSDDQPKRIKKSKMIAKAFSKRKELLRDPGQELSFSMHTVSHDGPVAGLAFDINEP
SADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEERASLWVVEADVSPELQKRSS
RKKKRRKKKKEVCPGPEHCLGASVAPLAPSTIPHLPRLPPQSCLVAFAPDILPGLPPSQP
EATFAGRPWDGCRRANVFHLISNPFCPESGSPEEESPGPSSRCQQHNGGLFWPPNPGTLP
HGRGTRTQGQRAVLAPIHSRTNLVEAELLDADSDF
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgcctaagtgtgaggatggccaggtggagctgcccagccagaccctctgccaggccacc
cgagccccctgcaccatcgtggagcgtgagcgtggctggcccgacttcctcaagtgcacg
cctgatcgcttccctgagggatgcccgaatgaggtgcagaacatcaagttcaatagctca
ggacagtgtgaggcaccactggtgcggacagacaaccccaagagttggtatgaggacgtg
gagggttgcggcatccagtgccagaatccactcttcaccgagaaggagcaccgtgaaatg
catgtctacatcgctgccttcagctctgtcaccatcttctgcaccttcttcaccctggcc
acattcgtcgctgactggaggaactccaaccgttaccctgccgttatcctcttctatgtc
aatgcttgcttcttcgtcggcagcatcggctggttggcgcagttcatggatggtgctcgc
aatgagatcgtgtgccgggctgatggcaccatgcggctgggagaacccacctccaacgag
acgctctcctgcgtcatcatctttgtcatcgtttactactcactgatgtcgggtgtcatc
tggttcgtcatgctgacctatgcctggcacacctccttcaaggcgctggggaccacctac
cagccgctgctgggcaagacctcctacttccacctcatcacctggtccatccccttcgtc
ctcactgttgccatcctggctgtggcacaggtggatggtgactctgtcagcggcatctgc
tttgtggggtacaagaactaccactaccgggctggcttcgtcctggcgcccattgggctt
gtcctcatcgtagggggctatttcctcatccggggtaccctcaccctgactacctcatcc
ttccactgcaggggttatgtgagtgagaaggcggccagcaagatcaatgagaccatgctg
cggctgggcatttttggcttcttggcctttggcttcgtcttcattacttttggctgccac
ttctacgacttcttcaaccaggcagagtgggagcgcagctttcgggaatatgtcctgtgc
gaagccaatgtgaccattgccacgcagaccaacaaacccatcccagactgtgagatcaag
aaccggccaagcttgctggtggagaagatcaatctctttgccatgtttggcaccggggtc
tccatgagcacctgggtctggaccaaggccaccctgctcatctggaaacgcacctggtgc
aggctgactgggcagagtgatgaccagcccaagaggatcaagaagagcaagatgattgcg
aaggccttctccaagcgcaaggagctgctgcgtgacccaggccaggagttgtcattcagc
atgcacacagtctcgcacgatggccctgtggctggcttagcatttgacatcaatgagccg
tctgctgatgtgtcctcggcgtgggcccagcacgttaccaagatggtggccaggagaggg
gctatcctgccccaggacatctctgtgacgcctgtggcgacgcctgtgccaccggaggag
agagccagcctctgggtggtggaggctgatgtatctcctgagctgcagaagcgcagcagc
cgcaagaagaagcggaggaagaagaagaaggaggtgtgcccaggccctgagcactgcctg
ggggcctctgtagcccctctggcccccagcaccatccctcacttgccccggctgcccccc
cagtcctgcctggtcgcctttgcccctgacatcctcccagggctcccgcccagccagcct
gaagccacctttgctgggaggccatgggatggctgccgcagagccaatgtcttccacctc
atcagcaaccccttctgccctgagagtggatccccagaggaggagagtcctggccccagc
agcaggtgccagcagcacaatgggggtctgttctggccccccaaccctggcacactgccc
cacggcagggggacgaggactcagggccaacgggctgtcttggcccccatccactctcgg
accaacttggtagaagcagagctgctggacgccgattcggacttttaa

DBGET integrated database retrieval system