KEGG   Falco peregrinus (peregrine falcon): 101922239
Entry
101922239         CDS       T02856                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04012  ErbB signaling pathway
fpg04068  FoxO signaling pathway
fpg04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101922239 (CDKN1B)
   04068 FoxO signaling pathway
    101922239 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101922239 (CDKN1B)
SSDB
Motif
Pfam: CDI US6
Other DBs
NCBI-GeneID: 101922239
NCBI-ProteinID: XP_005234805
LinkDB
Position
Un
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRQEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGSSPDFYFRPPRLLKTVCKSAGRQSLDVNGNCQTVVFVG
SQGISEDTHCVDQKTDVSENQTDFAEQCIGQRKRPATDDSCPQNKRANTTEEEVSEDSPS
ASSVEQTPKKSSPRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgaatttctaatgggagccctaccctggagcgcatggaagccaggcag
tcggagtacccgaagccgtcagcttgcaggaacctcttcgggccggtgaatcatgaagag
ttaaacagggacttgaagaagcaccgccaggagatggaggaggcatgccagaggaagtgg
aatttcgatttccagaatcacaagccactggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttctacttcagaccccccaggctactgaaaactgtctgcaag
tccgccggccgccagagcttggatgtaaacgggaattgccaaaccgtggtttttgtcggt
tctcagggaatctcagaggacactcactgtgtagatcaaaagactgatgtttctgaaaat
cagacggactttgcagagcagtgcattgggcagaggaaaagacctgccaccgatgattcc
tgtcctcaaaataaaagagccaacacaacagaagaagaggtttcagaagactcccccagt
gccagttcagtggagcaaacacccaagaaatcaagcccgagaagacatcaaacgtaa

DBGET integrated database retrieval system