KEGG   Falco peregrinus (peregrine falcon): 101922423Help
Entry
101922423         CDS       T02856                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00500  Starch and sucrose metabolism
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101922423
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101922423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 101922423
NCBI-ProteinID: XP_005237327
LinkDB All DBs
Position
Un
AA seq 512 aa AA seqDB search
MQVLLLLAAVGFCWAQYNPNTWAGRTSIVHLFEWRWADIALECERYLAPNGFGGVQVSPP
NENIIITNPNRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVHIYVDAVINHMCGA
AGGSGTHSTCGSYFNAGNRDFPAVPYSGWDFNDGKCRTGSGDIENYGDIYQVRDCRLVSL
LDLALEKDYVRSKVAEYMNHLIDIGVAGFRIDAAKHMWPGDLKAVLDKLNDLNTKWFSAG
TKPFIYQKVIDLGGEPIKGSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMAYLKNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSFRWP
RNFVNGRDVNDWVGPPSNADGSVRPVTINADTTCGNDWVCEHRWRQIKNMVIFRNVVDGQ
PFSNWWDNGSNQVAFGRGSKGFIVFNNDDWDLNISLQTGLPAGTYCDVISGEKEGNTCTG
EQVYVSGDGIARFHVGNNAEDPFVAIHVNAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtccttctcctactcgcagctgttgggttttgctgggcacagtacaaccccaat
acttgggctggaaggacgtctattgtacatctcttcgaatggcgctgggcggatattgct
ctggagtgtgagcgctatttagctcctaatggatttggaggagttcaggtttcacctcca
aatgaaaatattatcattactaaccccaacagaccctggtgggaaagataccagcctgtc
agctacaagctctgcactcgatcaggaaatgaaaatgaattcagagacatggtgaccaga
tgcaacaacgttggagttcatatttatgtggatgctgttatcaaccacatgtgtggggct
gcaggtggctcaggcacacattctacctgtggaagctattttaatgctggaaacagagat
tttccagctgtgccatactctggctgggatttcaatgatggcaaatgtcgaactggaagt
ggagacatcgaaaattatggtgatatatatcaggtccgagactgccgcttggtgagcctt
cttgatctggccctggagaaggactatgtccgctcaaaagttgctgagtacatgaaccac
ctcattgatatcggtgtagcaggcttccgaattgatgctgccaagcatatgtggccgggg
gacctgaaggcagttttagacaagctgaatgacctaaacacgaaatggttttctgcagga
actaaacctttcatttaccaaaaggtgattgacctgggtggagagccgatcaaaggcagc
gactactttggaaatggccgagtgacagaattcaaatatggtgcgaaactggggacggtg
atccgcaagtggaacggggaaaagatggcgtacttaaagaactggggagaaggctggggc
tttgtgccttccgacagagccctggtctttgtggataatcacgacaaccagcggggccac
ggggccggtggagcttccattctaacgttctgggacgccaggctttataagatggcagtt
ggtttcatgcttgctcatccatatgggttcacgcgtgtgatgtcaagttttcgctggcca
agaaactttgtcaatggacgggacgtcaatgactgggttggaccgccgagtaacgcggat
ggatcagtaaggcccgttacaatcaatgcagacactacctgtggcaacgactgggtttgt
gaacatcgctggcgtcaaataaagaacatggtcatcttccgtaatgtggtggacggtcag
cctttctccaactggtgggacaacggcagcaatcaagtggcttttggtcgtggtagtaaa
ggcttcatcgttttcaataatgacgactgggatctgaacatcagtttgcaaacgggactg
cctgctggtacctactgtgatgttatttctggagaaaaggaaggcaacacatgtactgga
gaacaggtctatgtttccggagacgggatagctcgtttccacgttggtaacaatgctgaa
gatccatttgttgcaattcatgttaatgctaagttataa

DBGET integrated database retrieval system