KEGG   Falco peregrinus (peregrine falcon): 101922474
Entry
101922474         CDS       T02856                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101922474 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101922474 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fpg04052]
    101922474 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:fpg00536]
    101922474 (FGF1)
Cytokines and growth factors [BR:fpg04052]
 Growth factors
  Growth factors (RTK binding)
   101922474 (FGF1)
Glycosaminoglycan binding proteins [BR:fpg00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101922474 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101922474
NCBI-ProteinID: XP_005233709
LinkDB
Position
Un
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTQSGQYLAMDTNGLLYGSQLLGEECLFLERIEENHYNTYVSKKHADK
NWFVGLKKNGNSKLGPRTHYGQKAILFLPLPISAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgagggggaaatcaccactttcaccgccctgaccgaaaagttcaacctaccccca
gggaactacaagaaacccaaactcctatactgcagcaacgggggccacttcctacggatc
ctgccagatggcaaagtggatgggaccagggaccgaagcgatcagcacattcaactccag
ctaagtgcggaaagcgtgggagaggtgtatataaagagcacccagtctgggcagtacctg
gcgatggacaccaacgggctactttatggctcgcagttactgggtgaggagtgtctgttc
cttgagaggattgaagaaaaccattacaacacatacgtctccaaaaagcacgcggataag
aactggtttgtaggtctgaagaagaatgggaacagcaagctggggccacggactcactac
ggccagaaggcaatccttttcctcccactgcccatctcggctgactaa

DBGET integrated database retrieval system