KEGG   Falco peregrinus (peregrine falcon): 101922530Help
Entry
101922530         CDS       T02856                                 

Definition
(RefSeq) trypsin I-P1-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04080  Neuroactive ligand-receptor interaction
fpg05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101922530
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    101922530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fpg01002]
    101922530
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpg04147]
    101922530
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101922530
Peptidases [BR:fpg01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101922530
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101922530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 101922530
NCBI-ProteinID: XP_005234460
LinkDB All DBs
Position
Un
AA seq 250 aa AA seqDB search
MKYILFVTFVGVAVAFPSIADDDDDDKIVGGYTCAANSVPYQVSLNSGYHFCGGSLISSQ
WVLSAAHCYKSRIQVQLGKHNLALTESTQQFINSAKVIRHPGFSASTLDNDIMLIKLSKP
AQLNRAVQTIPLPTSCVATGTTCLISGWGDTMSSTNPYPDTLQCLKAPVLSSSVCTKAYP
GKITKNMICVGFMEGGKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQKGYPGVYTKVCNYV
SWIRSTMSSN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatactgtttgtcacctttgttggtgtggctgttgccttccccagcatcgct
gatgacgatgatgatgacaagattgtgggaggctacacctgtgcggcaaactctgtcccc
tatcaggtgtccctgaattctgggtatcacttttgtggaggttccctcatcagcagccag
tgggtcctgtcagctgctcactgctacaagtctcgcatccaggtacagcttgggaaacat
aacctggcactcacagaatcgacgcagcagttcatcaattcagctaaagtcatccgccac
cctggcttcagtgcctccacgctggacaatgacattatgctcatcaagctttccaaacca
gcccagctcaaccgagccgtccagaccattcctctgcccaccagctgtgtggccacaggc
accacatgcctcatctctggctggggcgacacgatgagcagtaccaatccctacccagac
accttgcagtgcctgaaggctcctgtactttcctcaagcgtgtgcaccaaagcctaccct
gggaaaattaccaagaacatgatatgtgtaggattcatggagggaggcaaagactcctgc
cagggggattctggcggtccagtggtctgcaacgggcagctccagggcattgtttcctgg
ggtatcggatgtgcacagaaaggctatcccggggtttacactaaggtctgcaattatgtc
tcctggattagatcaactatgtcttccaactga

DBGET integrated database retrieval system