KEGG   Falco peregrinus (peregrine falcon): 101922747
Entry
101922747         CDS       T02856                                 

Gene name
MGRN1
Definition
(RefSeq) mahogunin ring finger 1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04120  Ubiquitin mediated proteolysis
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101922747 (MGRN1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101922747 (MGRN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fpg04121]
    101922747 (MGRN1)
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101922747 (MGRN1)
Ubiquitin system [BR:fpg04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101922747 (MGRN1)
SSDB
Other DBs
NCBI-GeneID: 101922747
NCBI-ProteinID: XP_013160171
LinkDB
Position
Un
AA seq 565 aa
MGSLLSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDL
NFLGNRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDVDSPTEENGKQKVLYSL
EFTFDADARVAITIYCQATEEFVGGMAVYSTKNPSLQSETVHYKRGVSQQFSLPSFKIDF
SDWKDDELNFDLDRGVFPVVIRAVVDEGDVVVEVTGHAHVLLAAFEKHVDGSFSVKPLKQ
KQIVDRVSYLLQEIYGIENKNNQETKGNVEVLPRMTVKSVSFLQALKKLRDDRSSLLKGP
TVGGVVLSLQMTRTVTTATSVWFACLTSVTRSFCPADTSVCAIPVLTPCATRPTTAPSAG
CSSDNIPPGYEPISLLEALNGLRSVSPSIPSAPLYDEISYSGVVDGMPPASRPLVGMDRA
VESSHQKGKRSKSPDSTLRSPSSPIHEEDEEKLSEDSDSQPALSGGELVLREASSPESAA
GEEIEEASSLQQGSRPPSVEDVLQDGSCGEHRSLTQSESDPPVDVYLPGSSDFTKTLPGR
GTGSPTQPLLFEQTCLHLEDEQNLS
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgggctccctgctcagccggcgcatcgcgggcgtggaggacatcgacatccaggccaac
tcggcctaccgctacccgcccaagtccggaaactactttgcaagtcacttctttatggga
ggcgagaagtttgacacccctcaccccgagggctacctttttggcgagaacatggatcta
aacttcctcgggaatagacctgtccagtttccctatgtaactccagctccacatgagccg
gtgaagacactgagaagtctggtgaatatccgcaaagattctctccgacttgtgaggtat
aaagatgatgttgatagtcctactgaggagaatgggaagcagaaagtcctgtacagcctg
gagttcacgtttgacgcagatgcccgtgttgccatcactatctactgccaggctacagaa
gagtttgtcggtggtatggcagtatacagcacaaagaatccctctctgcagtcggagacg
gttcattacaagagaggggtaagccagcaattctccctgccttccttcaagattgatttc
tcagactggaaggacgatgagctgaactttgacttggatcgtggcgtgttccctgtggtt
atccgagcagtggtggatgaaggggatgtggtggttgaggtgacgggtcatgcccatgtt
cttctggctgcatttgaaaagcacgttgatggcagtttttctgtgaagcctttaaaacag
aagcagatcgttgaccgagtgagttatctgcttcaggagatctatggcatcgagaacaaa
aacaaccaagagaccaagggcaacgtggaggtgcttcccagaatgactgtcaagtctgtg
tcattcctacaagcactgaagaagctgagagatgacaggtcctcactgttgaaaggccca
acagttggtggagttgtgctaagccttcagatgacgagaacagtgacaacagcaacgagt
gtgtggtttgcctgtctgacctccgtgacacgctcattctgccctgcagacacctctgtc
tgtgcaattcctgtgctgacaccctgcgctaccaggccaacaactgccccatctgcaggc
tgcagctctgacaatatccctccgggctatgagcctatttccttgctggaagcgctgaat
ggccttcgctccgtttccccctccatcccatcagctcctctgtatgatgaaatcagctac
tctggtgtggtggatgggatgccaccggcaagccgaccgcttgttgggatggacagagcc
gtggagagcagccaccaaaagggcaagcggagcaagtctccagatagcacactacggtct
ccctcgtccccaatccacgaggaggatgaagagaagctctctgaggactctgactcgcag
ccagcacttagcgggggtgagctggtcctgagagaggcgagctctccagaaagcgcggcc
ggggaggagattgaggaggcctcgtccctgcagcagggtagccgcccgccctccgtggaa
gatgtcctgcaggacggcagctgtggcgagcacaggagcctgacgcagtcggagagcgac
cctccggtagatgtctacctgccaggctcatccgacttcaccaaaacgctccctggccgc
ggcaccggcagccccacgcagccccttctcttcgagcagacgtgtcttcacctggaggac
gaacagaacctctcgtga

DBGET integrated database retrieval system