KEGG   Falco peregrinus (peregrine falcon): 101923004Help
Entry
101923004         CDS       T02856                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00250  Alanine, aspartate and glutamate metabolism
fpg00410  beta-Alanine metabolism
fpg00430  Taurine and hypotaurine metabolism
fpg00650  Butanoate metabolism
fpg01100  Metabolic pathways
Module
fpg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101923004 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101923004 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101923004 (GAD1)
   00430 Taurine and hypotaurine metabolism
    101923004 (GAD1)
Enzymes [BR:fpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101923004 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DegT_DnrJ_EryC1 OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101923004
NCBI-ProteinID: XP_005237155
LinkDB All DBs
Position
Un
AA seq 563 aa AA seqDB search
MLGSEKTLTCAPCNNNVGFLQRTNSLEDKGRIVSSLKERQSSKSLLTCENSEKGSRFRRT
ETDFSNLYARDLLPAKNGEEQTMQFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGM
EGFNLELSDNPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTANT
NMFTYEIAPVFVLMEQITLRKMREIIGWSNKDGDGIFSPGGAISNMYSIMAARYKYFPEV
KTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADLEAKILEA
KQKGYIPLFVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLN
GIERANSVTWNPHKMMGVLLQCSAILVREKGILQGCNQMCAGYLFQQDKQYDVSYDTGDK
AIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYTKIKNREEFEMVFEGEPEHT
NVCFWYIPPSLRGMPDCDERREKLHRVAPKIKALMMESGTTMVGYQPQGDKVNFFRMVIS
NPAATKSDIDFLIEEIERLGQEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgttgggaagtgagaaaactctgacctgtgcaccttgcaataacaatgtagggttcctg
caaaggaccaacagcctggaagacaagggccggatcgttagctccctgaaggaaaggcag
tcctccaagagcctgctgacatgcgagaacagcgagaagggatccaggttccggcgcacc
gagacagacttctccaatttgtatgccagagatttgctgcccgccaagaatggcgaggag
cagaccatgcagttcctgctggaggtcgtggacatcctcctcaactacgtgaggaagacg
tttgacaggtccaccaaagtgctggacttccaccacccgcaccagctcctggagggcatg
gagggctttaacctggagctctcggacaaccccgagtccctggagcagatcctggtggac
tgtcgggacacactgaaatacggagtgaggacaggtcatcctcgctttttcaaccagctg
tccacagggctggacatcatcggcctggcgggggagtggctgacatccaccgctaacacc
aacatgtttacctatgaaattgcccctgtttttgtcctcatggaacaaataacacttcga
aagatgagagagattattggatggtcaaataaagatggtgatggaatattctcacccgga
ggagctatctccaacatgtacagcataatggctgcacgctacaagtatttccctgaagtc
aaaaccaaaggcatggctgcagttcctaaactggttctctttacctcggaacatagtcac
tactcaataaagaaagctggagctgcacttggatttggaacagacaatgtgattttgata
aaatgcaatgaaagaggcaagataataccagctgatttggaggcaaaaattttggaagca
aaacaaaagggatatattcctctctttgtaaatgcaactgcaggcacaacagtatatgga
gcctttgatccaatacaggagattgcagatatatgtgaaaaatataacctctggctccat
gtagatgctgcctggggaggtgggctcttaatgtcccgaaagcatcgtcataaattgaat
ggaatagaaagagccaactcagtcacttggaatccacacaagatgatgggagtgttgtta
caatgttctgccattcttgtccgggaaaagggtatactccaaggctgcaatcaaatgtgt
gcaggctatctcttccagcaagacaagcagtatgatgtatcctatgacactggagataag
gcgatacaatgtggtcgacatgtggacattttcaaattctggttgatgtggaaggcaaag
ggtacagtaggatttgaaaatcagatcaacaaatgcctggagctggcggaatatctctac
actaaaataaaaaacagagaagaatttgagatggtttttgaaggggagccagagcataca
aatgtatgtttttggtatattccgccaagtctcaggggcatgccagactgtgatgagaga
agagaaaagttacacagggtggcaccgaaaatcaaagcactgatgatggagtcaggtacg
accatggttggatatcagcctcagggcgataaagtcaacttcttccgaatggtcatctca
aacccagcagcaactaaatctgacattgacttcctcattgaggaaatagagagattgggg
caggagctgtag

DBGET integrated database retrieval system