KEGG   Falco peregrinus (peregrine falcon): 101923880Help
Entry
101923880         CDS       T02856                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00010  Glycolysis / Gluconeogenesis
fpg00053  Ascorbate and aldarate metabolism
fpg00071  Fatty acid degradation
fpg00280  Valine, leucine and isoleucine degradation
fpg00310  Lysine degradation
fpg00330  Arginine and proline metabolism
fpg00340  Histidine metabolism
fpg00380  Tryptophan metabolism
fpg00410  beta-Alanine metabolism
fpg00561  Glycerolipid metabolism
fpg00620  Pyruvate metabolism
fpg01100  Metabolic pathways
Module
fpg_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101923880 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    101923880 (ALDH2)
   00620 Pyruvate metabolism
    101923880 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101923880 (ALDH2)
   00561 Glycerolipid metabolism
    101923880 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101923880 (ALDH2)
   00310 Lysine degradation
    101923880 (ALDH2)
   00330 Arginine and proline metabolism
    101923880 (ALDH2)
   00340 Histidine metabolism
    101923880 (ALDH2)
   00380 Tryptophan metabolism
    101923880 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101923880 (ALDH2)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101923880 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 101923880
NCBI-ProteinID: XP_005237662
LinkDB All DBs
Position
Un
AA seq 492 aa AA seqDB search
MGVVLEPAQAESLIFINNEWHDAVSKKTFPSINPATGEVICQVAEGDKADVDKAIKAAKA
AFQLGSPWRRMDASHRGKLLNRLADLIERDRAYLAALETLDNGKPYSVAYLVDLDMVIKC
LRYYAGWSDKFHGKTIPIDGDFFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNV
IVMKVAEQTPLSALYVASLIKEAGFPPGVVNIIPGYGPTAGAAISSHMDVDKVAFTGSTE
VGHLIQKAAAESNLKRVTLELGGKSPNIIMSDADMDWAVDQAHFALFFNQGQCCCAGSRT
YVQEDIYHEFVERSVEKAKARVVGNPFDFKTEQGPQVDEEQFKKILGYISAGKREGAKLL
CGGNPAADRGYFIQPTVFGDVQDNMTIAREEIFGPVMQILKFKTIEEVIERANDSKYGLA
AAVFTKDLDKANYVSQGLRAGTVWINCYDVFGAQAPFGGYKASGNGRELGEYGLEAYVEV
KNVTIKVPQKNS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtagttttggagcctgcccaagctgagtccctgattttcataaataacgaatgg
cacgatgcagtcagtaagaaaaccttcccttccatcaatccagcaacgggagaagttatc
tgccaggttgctgagggtgataaggcagatgtggacaaggccattaaggcagccaaagca
gctttccagctgggctcgccttggaggaggatggatgcttctcatcggggaaagctgctg
aatcgtcttgctgacctgatcgagagggaccgggcttacctggcggcactggaaactctg
gataatggcaaaccctactcagtcgcctacctggtggatttggacatggtcatcaaatgt
ctgagatactatgcaggctggtcagataaattccatggcaaaaccatcccgatagatgga
gacttcttctgttatacaagacatgagccagtgggagtctgtggtcagataattccgtgg
aacttcccgctgttgatgcaagcatggaaacttgggcctgccctggctactgggaatgtg
attgtgatgaaagtggcagagcaaaccccgctgagtgctctctacgtagctagtttgatc
aaagaggctggattcccaccaggtgtggtaaacatcatccctggctacgggcccactgca
ggggctgccatctcttcccacatggatgtagataaagtggcattcaccggctccacggag
gttgggcatttgatccagaaggctgcagcagagagtaacttaaagagggtgacactggag
cttggaggaaagagtccaaatataatcatgtctgatgcagacatggactgggctgtggat
caagcccattttgccctcttcttcaaccaagggcaatgctgctgtgctggctcccgaaca
tatgtccaggaagatatatatcatgagtttgtggagaggagtgttgagaaggccaaggcc
agggtggttggaaacccatttgactttaaaactgaacaggggcctcaggtagatgaggag
cagtttaagaagatcctcggttacattagtgctgggaagcgtgaaggagccaaactgctg
tgtggcggcaaccccgctgcagacagaggctatttcatccagccaactgtctttggtgat
gtgcaggacaacatgacgattgccagagaggagatatttgggccggtcatgcagattctg
aaattcaaaacaattgaggaagtcattgagagagcaaatgactccaagtatggcctagca
gcagcagtctttacaaaggatcttgacaaagcaaactatgtgtcacagggcctgcgagct
ggaacagtttggataaactgctatgatgtgtttggtgcccaagccccatttggtggctac
aaagcttctgggaatgggcgagagctgggagaatatggtctggaggcatatgtagaggtg
aaaaacgtgacaatcaaagttccacagaaaaactcttaa

DBGET integrated database retrieval system