KEGG   Falco peregrinus (peregrine falcon): 101924021Help
Entry
101924021         CDS       T02856                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00052  Galactose metabolism
fpg00500  Starch and sucrose metabolism
fpg01100  Metabolic pathways
fpg04142  Lysosome
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101924021
   00500 Starch and sucrose metabolism
    101924021
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101924021
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpg04147]
    101924021
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101924021
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101924021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101924021
NCBI-ProteinID: XP_005229026
LinkDB All DBs
Position
Un
AA seq 928 aa AA seqDB search
MKSYQKLTTTVPQPAACRVEEEGAASTPTGRGKLAPWWVGSGLLVAAVLLSTITVWVLRQ
VSGGWPRPTLPPKCLLVPENHRFDCYPERHVVVTQELCESRGCCFMETPPPAGGKRGVPW
CFYPPDFPSYTLESLNQTALGMVGLLVRREKAYYPQDIRMLRLDVEFQTDTRLHIKITDA
TNPRYEVPLEVPQTMKRAENPIYSLDFSWDPFGVLLRRKATGTVLLNTTVAPLIFANQFL
QISTSLPSKFLYGLGEHRGTFLHSLDWNTLTLWARDVAPTESFNLYGAHPFYLLMEEGGD
AHGVFLLNSNAIEVALQPAPGLTWRTIGGVLDFYIFLGPDPNMVIQQYQQVIGFPAMPPL
WALSFHLCRWGYGSSNETWEIVRAMRNYRIPQDVQWNDIDYMDGYRDFTFDPQKFASLPS
LVEDLHKHGQRYVMILDPGISSTNPHGSYWPFDEGLRRGLFLNTTQGQPLIGQVWPGFTA
FADFSNPDTHQWWLENLQHFHAHVPFDGLWIDMNEPSNFMDGSEDGCPPGELDSPPYTPA
VLGDSLSAKTVCASAKQKASVHYNLHNLYGLMEAKATASALIQIRGKRPFVISRSTFPSQ
GQYSGHWLGDNRSQWKDMYYSIPGMLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGA
FYPFARNHNTQNEQAQDPTAFSPAARTAMKDVLLTRYSLLPFLYTLFHRAHLQGDTVARP
LFFEFPQDVATLGLDRQFLWGQSLLVTPVLEPGVDSVTGYFPRGVWYDFYTGSSVNSSGE
TLKMSAPLEHLNLHVREGAILPTQKPGTTSEVTRGNPMRLIVALSSSATAWGDLFWDDGE
SLDTFEQGSYSYLVFNVTQNIFTSTVLHASTEATEVTIGTLSIFGVRQPPSKVLLNGQER
PFSYLDNQVLTVTDLGLSLSRGFSLRWL
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtaccagaagctgacgacaacagtgccgcagccagcagcatgtcgggtggag
gaggaaggggctgcctcaacacccactggccgtgggaagctggccccgtggtgggtgggc
agcgggctgctggtggctgctgtgctgctgagcaccatcacggtctgggtgctacggcaa
gtatcagggggctggcccagacccacactgccccccaaatgtctcctggtgcctgaaaac
caccgctttgactgctacccggagcggcatgtcgtggtgacccaggagctctgcgaaagc
cgggggtgctgcttcatggagaccccgccgccggcagggggcaagcggggagtgccctgg
tgcttctacccccctgacttccccagctacaccctggagagcctcaaccagacagcgctg
ggcatggtggggttgctggtgcggagggagaaggcttattacccccaggacatcaggatg
ctgaggctggacgtggagtttcagacagacacgcggctgcacatcaagataactgatgcg
accaatccacggtatgaggttcccctagaggttccccagacgatgaagagggcagaaaac
cccatctacagtctggatttctcctgggacccctttggggtgctgctgcggcgcaaggcg
acagggacagtgctgctcaacaccaccgtggcccccttgatctttgctaaccagtttctc
cagatatccacatcgctcccgtccaagttcctctatgggctgggggagcaccgtggcacc
ttcctgcacagcctggactggaacaccctcacactgtgggcccgtgacgtcgctcccacg
gaatcgttcaacctgtacggtgctcatcccttctacctgctgatggaggagggcggagat
gctcacggggttttcctcctcaacagcaatgcaatagaggtggccctgcagcctgctccg
ggcctgacctggaggaccattgggggggtcctggatttttacatcttcctggggcctgat
cccaacatggtcatccagcagtaccagcaggtgataggtttcccagccatgccacccctc
tgggcactcagcttccacctctgccgctggggctatggatccagcaatgagacctgggag
attgtaagagccatgaggaactaccggatcccccaggatgtgcagtggaatgacatcgat
tacatggatgggtaccgggactttaccttcgatccccagaaatttgcctccctcccctcg
ctggtagaagacctccacaaacatgggcagcgctacgttatgatcttggatcccggcatc
agcagcaccaaccctcacggctcctactggccttttgacgaaggcttgagacggggcttg
ttcctcaacaccacccaagggcagccactcatcgggcaggtctggcccggcttcactgcc
tttgcagacttctccaacccagacacgcaccagtggtggctggagaacctgcagcacttc
catgcccacgtgccctttgatgggctctggatcgacatgaatgagccgtccaacttcatg
gatgggtctgaagacggctgccccccaggagagctggacagcccaccctacacaccggcc
gtgctgggtgattccctctctgcaaagacggtgtgtgcctcagcgaagcagaaagcctca
gtgcactacaacctccacaacctctacgggctgatggaagccaaagccacagcaagcgct
ctgatccagatccgggggaagcgcccctttgtcatctcccgctccaccttccccagccag
ggccagtactcggggcactggctgggtgacaaccggagccagtggaaggacatgtattac
tccatcccagggatgctgagcttcagcctcttcggcatcccgctggttggggcggacatc
tgcggcttctccggcagcacctcagaggagctgtgcacccgctggatgcagctcggtgcc
ttctaccccttcgctcgcaaccacaacacccagaacgagcaggcccaggacccaacagca
ttcagccccgcagcaaggacggccatgaaggatgtgctgctgacccgctactccctcctg
cccttcctctacactcttttccaccgtgcccacctgcaaggggacactgtcgcccggccc
ttgttctttgagttcccccaggatgtggccaccttgggactggacaggcagttcctgtgg
ggccagagcctgctggtgacgccagtgctggagcccggggtggactcggtcacaggctac
ttcccccgaggcgtatggtacgacttctacacgggctcctcggtgaacagcagcggggag
acactgaagatgtcagcccccctggaacacctcaacctgcatgtccgggagggtgccatc
ctgcccacccagaaaccagggaccaccagtgaggtgacccgagggaaccccatgcgcctc
atcgtggctttgtcctcgagtgccaccgcctggggggacctcttctgggatgatggcgag
agcctggacaccttcgagcagggcagctactcctacctggtgtttaatgtcacgcagaac
atcttcacctccaccgtcctccatgccagcactgaggctactgaggtcaccattggcaca
ctgagcatctttggggtgcggcagccacccagcaaggtcctcctgaatggccaggagagg
cccttctcctacctggacaaccaggttctcaccgtgaccgacctcggcctcagcctcagc
cggggcttctccctgcggtggctgtga

DBGET integrated database retrieval system