KEGG   Falco peregrinus (peregrine falcon): 101924458
Entry
101924458         CDS       T02856                                 

Gene name
SUFU
Definition
(RefSeq) SUFU negative regulator of hedgehog signaling
  KO
K06229  suppressor of fused
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101924458 (SUFU)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 101924458
NCBI-ProteinID: XP_013155939
LinkDB
Position
Un
AA seq 447 aa
MSFLLLSCAGNSCARWTLRGHYRLGGPDPLDYVSMYRNLGNPALNVPEHWHYVSFGLSDL
YGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSG
DHVSWHSPLDNSESRIQHMLLTEDPQMQPVQTPFGVVTFLQIVGVCTEELHAAQQWNGQG
ILELLRTVPVAGGPWLITDMRRGETIFEIDPHLQQERVDKGIETDGSNLSGVSAKCAWDD
LSRPPEDDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINAQRQNGLNH
DRAPSRKDSLESESSAAIIPHELIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTY
KSITGDTAITFVSTGVEGAFATEEHPYAAHGPWLQILLTEEFVERMLEDLEDLNSPEEFK
LPKEYSWPEKKLKVSILPDAVFDNPLH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagcttcttactgctgtcctgtgcaggaaattcttgtgcaaggtggaccctacgtgga
cactacaggttgggaggacccgaccctctagactatgttagcatgtacagaaacctggga
aacccagcgcttaatgttcctgagcactggcactacgtcagctttgggttaagcgacttg
tatggagacaacagagtacatgagtttacaggaacagatggaccaagtggctttggcttt
gagctgacatttcgactaaagagagaaacgggggagtcggcaccacctacctggccagca
gagttaatgcaaggtttagccagatacgtcttccagtcagaaaacaccttctgcagcggt
gaccatgtatcgtggcacagccctttggacaacagtgaatctagaatccagcatatgtta
ctgacagaagaccctcagatgcagccagtgcagactccttttggggttgttacttttcta
cagattgttggggtttgcactgaggaactacatgcagctcagcagtggaatgggcaaggg
atcttggaactgcttcgaactgtcccagtagctggaggcccctggttgataacagatatg
cgaagaggagagacaatattcgagattgacccacatctgcaacaggaaagagtcgataaa
gggattgagacagatggctcaaacctgagtggagtgagtgccaaatgtgcctgggatgat
ctcagccgacccccagaggatgatgaagacagcaggagcatttgcattgggacccagcca
cggcggctctctggaaaagatacagagcaaatcagggagactttgcggagagggcttgag
attaacagcaaacctgttctacctccaataaatgcacaaagacagaacgggttgaaccat
gaccgagcaccaagccgtaaggacagtttagaaagcgagagctcagcagctatcattcct
catgagctaatccgcacgaggcagctggagagtgtacacctgaaatttaaccaggagtcc
ggagcactcattcccctctgtctaaggggaaggctgttacatggacggcactttacatat
aaaagtattacaggggatacagcaatcacgtttgtatcaacgggagtagaaggagccttt
gctacagaagagcacccttatgcagcacatggaccttggttacaaatcctattgactgaa
gagtttgtagagagaatgctggaagatttagaagatctgaattctccagaggaatttaaa
cttccaaaggagtacagctggcctgaaaagaaactgaaagtttccatcttgccagatgcc
gtgttcgacaacccgttgcattag

DBGET integrated database retrieval system