KEGG   Falco peregrinus (peregrine falcon): 101924512Help
Entry
101924512         CDS       T02856                                 

Gene name
METAP1D
Definition
(RefSeq) methionyl aminopeptidase type 1D, mitochondrial
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fpg01002]
    101924512 (METAP1D)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     101924512 (METAP1D)
Peptidases [BR:fpg01002]
 Metallo Peptidases
  Family M24
   101924512 (METAP1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-GeneID: 101924512
NCBI-ProteinID: XP_005237165
LinkDB All DBs
Position
Un
AA seq 346 aa AA seqDB search
MWEKRVESIWRGGDPLYQLVSCSVTRCHIIFSSCNCIYLHRQSSNQQRRCFFFQGQRNTA
YSIVWPATVSPAHPVPKHIKKPDYVTTGIVPDWGDDIEIKNEDQIQGLRQACQLARHVLL
LAGKGLKVGMTTEEIDSIVHHEIIRQNAYPSPLGYGGFPKSVCTSVNNVVCHGIPDSRPL
QDGDIINIDVTVYYNGYHGDTSETFLVGNVDKSGEKLVEVARKCRDEAIAACRPGAPFSV
IGNTISSVARRGGFQVCPSFVGHGIGSYFHGHPEVWHHANDSDLLMEEGMAFTIEPIIME
GSPEFKILKDKWTAVSVDNKRSAQFEHTIVITSEGAEILSKLFEEA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaaaacgtgtggaaagcatctggagaggaggagaccccctttaccagcttgtt
tcctgttctgtgactcgctgccacataatcttttcttcgtgtaattgtatctacctgcac
aggcagtcaagcaatcaacagcgaagatgcttcttttttcaaggacaaagaaatactgct
tatagtatagtttggccagccacagtttctccagctcacccagttcctaagcacataaag
aagccagactatgtgacgacaggcattgtaccagactggggagacgacatagaaattaag
aacgaagatcagattcaagggcttcgtcaagcttgtcagttggcccgtcatgtcctgctt
ctggctggaaagggcttaaaggttggcatgacaactgaagaaatagattctattgttcat
catgaaataatcagacagaatgcctatccatcacctctgggctatggaggttttccaaaa
tctgtttgtacttctgtaaacaacgtggtatgtcatggtattcctgacagtcgacctctt
caggatggagatattatcaacattgatgtcacggtgtattacaatggctaccatggtgac
acttctgaaacctttttggtgggcaatgtggataaatctggtgaaaagttagtggaggtt
gccaggaaatgtagagatgaagcaattgcagcttgcagaccaggggctcccttctctgta
attggaaacacgatcagctccgtggcgcggcggggcggcttccaggtctgcccctctttc
gtcggccacggcatcgggtcgtacttccacgggcaccccgaggtgtggcaccacgccaat
gacagtgatttgttaatggaagagggaatggcgttcacaatagagccaataataatggaa
ggatcccccgaatttaagattctgaaggataaatggactgcagtttccgtagacaataaa
agatcagcgcagtttgaacataccattgtgattacttcagagggagcagaaatcctctct
aaactgtttgaagaagcctaa

DBGET integrated database retrieval system