KEGG   Falco peregrinus (peregrine falcon): 101924726Help
Entry
101924726         CDS       T02856                                 

Gene name
SMAD3
Definition
(RefSeq) SMAD family member 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04068  FoxO signaling pathway
fpg04110  Cell cycle
fpg04144  Endocytosis
fpg04218  Cellular senescence
fpg04350  TGF-beta signaling pathway
fpg04371  Apelin signaling pathway
fpg04520  Adherens junction
fpg04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101924726 (SMAD3)
   04371 Apelin signaling pathway
    101924726 (SMAD3)
   04068 FoxO signaling pathway
    101924726 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101924726 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    101924726 (SMAD3)
   04218 Cellular senescence
    101924726 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101924726 (SMAD3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101924726 (SMAD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 101924726
NCBI-ProteinID: XP_005235144
LinkDB All DBs
Position
Un
AA seq 441 aa AA seqDB search
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNI
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMEMCEYAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNYIPGT
IYLPYSEWREKGHITPPPGYLSEDGETSDHQMNPSMDAGSPNLSPNPMSPAHNNLDLQPV
TYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVE
LTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFN
NQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPL
QWLDKVLTQMGSPSIRCSSVS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccatcctgcctttcactccccccatcgtcaagcggctcctgggctggaagaag
ggggagcagaacgggcaggaggagaaatggtgcgagaaggcggtgaagagcctggtgaag
aagctgaagaagacggggcagctggacgagctggagaaggcgatcaccacgcagaacatc
aacaccaagtgcatcaccatccccagatcactagatggccggctgcaagtgtctcaccgg
aagggtcttccccatgtgatctactgccggctgtggcggtggccagaccttcatagccac
catgagctgcgtgccatggagatgtgcgagtatgcctttaacatgaagaaggatgaagtc
tgtgtgaatccttatcattaccaaagagtggaaaccccagtgttacctccagtgctggtg
cctcggcacacagagatcccagctgagttcccgccattagatgattatagtcattctatt
ccagagaacactaacttcccagcgggtatcgagccacagagcaactacattccaggtacc
atatatcttccatacagcgagtggagggaaaagggtcacattacacctcctccaggctat
ttgagtgaggatggagaaactagtgaccaccagatgaaccccagcatggatgcgggttct
ccaaacttatcaccaaaccctatgtctccagcacacaataatctggatctgcagcctgtt
acctactgcgagccagctttctggtgctcgatatcctactatgaactcaaccagcgagtg
ggagagactttccatgcctctcagccctctatgaccgtggatggtttcactgacccatct
aattctgaacgcttctgccttggtttactgtctaatgtgaacagaaatgcggcagtggaa
ctcacaagacgacacattggaagaggagtaaggctctactacattggcggcgaggtgttt
gccgagtgccttagtgacagtgccattttcgtccagtctcccaactgcaaccaacgctac
ggctggcacccagcaacagtttgcaagattccaccaggttgtaacctgaagatttttaac
aaccaggaattcgccgctctcttggctcagtctgtaaatcagggcttcgaagctgtgtac
cagctgaccagaatgtgcacgattcgaatgagctttgtcaagggatggggagcagaatac
aggcggcagactgtgaccagtactccctgctggattgaactacatcttaatggtcctttg
cagtggctagacaaggtccttacacaaatgggctccccgagtattcgttgttccagtgtc
tcctaa

DBGET integrated database retrieval system