KEGG   Falco peregrinus (peregrine falcon): 101924775
Entry
101924775         CDS       T02856                                 

Definition
(RefSeq) G-protein coupled receptor 161-like
  KO
K08439  G protein-coupled receptor 161
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101924775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fpg04030]
    101924775
G protein-coupled receptors [BR:fpg04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    101924775
SSDB
Motif
Pfam: 7tm_1 Dpy19
Other DBs
NCBI-GeneID: 101924775
NCBI-ProteinID: XP_005234473
LinkDB
Position
Un
AA seq 389 aa
MCWWLYRCYKNNYINTEEQVYSSGCLPPLFGWSSLEFDQFKWMCVVAWHKEAGYTAFWQI
WCALLPFMVMMICYGFIFRVARIKARKIHCGSIVIVEEDSQKNGRKNSSTSTSSSGSRRN
AFQGVVYSANQCKAFITILVVIGAFVITWGPYMVVITSEALWGKNSISPALETLATWLSF
SSAICHPLIYGLWNKTVRKELLGMCFGDRYYRESFVQRHRTSRLFSISNRITDLGLSPHL
TALMAGGRPLGNSSSTGETGFSCSQDSGTDAMLLEDYSSDGPHAPHCICPPRRRSSVTFE
DEIEQIKEAAKNSVLHVKAEVHKSLDSYASSLARAIEADVKISLFGEDALPGALFPVRTL
PGSSMNTRRGIRPHASQRLKLQSIDEGNI
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtgttggtggttatatagatgctacaaaaacaactacatcaacactgaagagcaggtg
tattcaagtggctgtctccctcccctttttggctggtcgtctttagagtttgaccaattc
aagtggatgtgtgtggtggcctggcataaagaggctggctacactgccttttggcagatc
tggtgcgcactgctgcctttcatggtcatgatgatctgctatggattcatattccgcgtg
gcaaggattaaggcccgcaaaatccactgtggtagcatcgtcattgtggaggaggactcc
cagaagaatgggaggaagaactccagcacctccacatcctcttctggcagccgacggaat
gctttccaaggggttgtctactcagccaaccagtgcaaagctttcataaccatcttggtt
gtcatcggtgctttcgtgattacgtgggggccttacatggtagtaattacatcagaggcg
ctttggggaaaaaatagtatttcccctgccttggagacattagctacatggttgtccttt
tccagtgccatttgccatccactaatttatggactgtggaacaagacagtgcgcaaggaa
ctactaggaatgtgctttggggatcggtattatcgtgagtcctttgttcagcgacacagg
acatcgaggttattcagcatttccaataggatcacagatttggggctatctcctcatctc
actgccctcatggcaggtgggcgaccattaggaaacagcagcagcacaggagagacaggt
ttcagctgctcacaggattcaggaacagatgcaatgcttcttgaagattatagctcagat
ggtcctcatgccccacactgcatttgtcctcctcgaaggaggagttcagtgacgtttgaa
gatgaaatagagcaaattaaagaagctgcaaagaattctgttcttcatgtaaaagccgaa
gtccataaatctctggacagttacgcatccagtttagcaagagctattgaagctgatgtg
aaaatcagcttgtttggggaagatgctttaccaggagctctgttccctgtgcggactctg
ccaggaagcagtatgaacacacggcgtggtatcagaccccatgctagccaaagacttaag
ttgcagagcatcgatgaagggaatatttga

KEGG   Falco peregrinus (peregrine falcon): 101924939
Entry
101924939         CDS       T02856                                 

Gene name
GPR161
Definition
(RefSeq) G-protein coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101924939 (GPR161)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fpg04030]
    101924939 (GPR161)
G protein-coupled receptors [BR:fpg04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    101924939 (GPR161)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 101924939
NCBI-ProteinID: XP_013152263
LinkDB
Position
Un
AA seq 471 aa
MSSNSSLSNVKGLRNLTTQEDGAVRVTESIAIIVIAIFICLGNLVIVITLYRKSYLLTLS
NKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSALLYMLISSASMLTLGLIA
IDRYYAVLYPMVYPMKITGNRAVVALVYVWLHSLIGCLPPLFGWSSLEFDQFKWMCVVAW
HKEAGYTAFWQIWCALLPFMVMMICYGFIFRVARIKARKIHCGSIVIVEEDSQKNGRKNS
STSTSSSGSRRNAFQGVVYSANQCKAFITILVVIGAFVITWGPYMVVITSEALWGKNSIS
PALETLATWLSFSSAICHPLIYGLWNKTVRKELLGMCFGDRYYRESFVQRHRTSRLFSIS
NRITDLGLSPHLTALMAGGRPLGNSSSTGETGFSCSQDSGTDAMLLEDYSSDGPHAPHCI
CPPRRRSSVTFEDEIEQIKGGFRDKCGKTQNYLYCLLRKPPMSFRIVLKHL
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgagcagcaattcctccctcagcaatgtgaagggcctgaggaacctcaccacgcaggaa
gatggggcggtcagagtcacagagtccatcgctatcatcgtcattgctattttcatctgt
ttgggcaacctggtgattgtcatcaccctgtaccggaaatcttaccttctcacgctgagc
aacaagtttgtgttcagcctgaccctctccaactttctactctctgtactggtgctacct
tttgttgtcaccagctccatcaggcgagaatggatcttcggagttgtttggtgcaatttc
tcagccctgctctacatgctgatcagctcagccagcatgcttactcttggactcatagct
atagacaggtactatgctgtcctgtacccgatggtttacccgatgaagataacgggcaac
agagcagtggtagctcttgtgtatgtgtggctacattcccttattggctgtctccctccc
ctttttggctggtcgtctttagagtttgaccaattcaagtggatgtgtgtggtggcctgg
cataaagaggctggctacactgccttttggcagatctggtgcgcactgctgcctttcatg
gtcatgatgatctgctatggattcatattccgcgtggcaaggattaaggcccgcaaaatc
cactgtggtagcatcgtcattgtggaggaggactcccagaagaatgggaggaagaactcc
agcacctccacatcctcttctggcagccgacggaatgctttccaaggggttgtctactca
gccaaccagtgcaaagctttcataaccatcttggttgtcatcggtgctttcgtgattacg
tgggggccttacatggtagtaattacatcagaggcgctttggggaaaaaatagtatttcc
cctgccttggagacattagctacatggttgtccttttccagtgccatttgccatccacta
atttatggactgtggaacaagacagtgcgcaaggaactactaggaatgtgctttggggat
cggtattatcgtgagtcctttgttcagcgacacaggacatcgaggttattcagcatttcc
aataggatcacagatttgggactatctcctcatctcactgccctcatggcaggtgggcga
ccattaggaaacagcagcagcacaggagagacaggtttcagctgctcacaggattcagga
acagatgcaatgcttcttgaagattatagctcagatggtcctcatgccccacactgcatt
tgtcctcctcgaaggaggagttcagtgacgtttgaagatgaaatagagcaaattaaaggt
gggtttagggataaatgtggaaaaactcagaattacctatattgcctgctcaggaagcct
cccatgtctttcagaattgttttaaaacatctctga

DBGET integrated database retrieval system