KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0903Help
Entry
Fphi_0903         CDS       T00652                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00250  Alanine, aspartate and glutamate metabolism
fph00410  beta-Alanine metabolism
fph00430  Taurine and hypotaurine metabolism
fph00650  Butanoate metabolism
fph01100  Metabolic pathways
fph01110  Biosynthesis of secondary metabolites
fph01120  Microbial metabolism in diverse environments
fph02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Fphi_0903
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Fphi_0903
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Fphi_0903
   00430 Taurine and hypotaurine metabolism
    Fphi_0903
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Fphi_0903
Enzymes [BR:fph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Fphi_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABZ87126
UniProt: B0TWL8
LinkDB All DBs
Position
969060..970400
Genome map
AA seq 446 aa AA seqDB search
MALHAKNDMKHKLYKESLPKFEIPKKSNDAFEAYQQIKDELMLDGNSKQNLATFCQTEVD
DFIHRLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAAML
GGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMTPE
TMLKYCDENTIGVVPTLGVTFTGQYEPVEAVCEALDKFERDTGIDIPVHVDAASGGFLAP
FVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVVWADKKYLPQDLIFNVNYLGGDMPT
FALNFSRPGGQIVAQYYNFVKLGFEGYKNIHKLSYDVAKYIAKEIKDMGIFDIIHAGKGG
IPAVSWSLKAGKSYDLFDISEKIRARGWQIAAYSMPKDRQDLVVMRVLVRRGFSFDLAEL
MIRDLKNVINSLDNKSKDIERGGFSH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcgttacatgccaaaaatgacatgaaacataagttgtataaagaatcattaccaaaa
tttgaaattcccaaaaaatcaaatgatgctttcgaagcatatcaacaaatcaaagatgag
ctaatgctcgatggtaattcaaagcagaatttagcgacattttgtcaaacagaagttgat
gatttcattcataggcttatggatgattgcattgataagaatatgattgataaagatgag
tatcctcaaactgctgaaatagagtcacgatgtgtcaacatactagcaaacctatggaac
tcttcagcagaaaatgcaatcggctgttcaactactggctcatctgaagcagctatgctt
ggcggtatggcaatgaagtggcgctggcgtgataagatgaaagcacaaggtaaagattat
acaaaacctaatcttgttacaggacctgtgcaagtctgctggcataaattcgctagatat
tgggatattgagcttagagagattccaatgtcaaatgaaagtttaataatgactccagaa
actatgcttaagtactgtgatgaaaatacaattggagttgtgccgactttaggggttacc
tttacaggtcagtacgagcctgttgaggcagtttgtgaagcacttgataaatttgagaga
gatactggtattgatattccagtgcatgtagatgctgcttctggaggatttttggcacca
tttgtagagcctgaacttaagtgggattttagattaccaagagttaagtcaattaattca
tcaggacataagtttgggttatcgccattaggagtgggttgggttgtttgggcagataag
aaatacttacctcaagatttgatttttaatgttaattatcttggtggtgatatgccgaca
tttgctttgaatttctctcgacctggtggtcagatagttgcccagtattataactttgtt
aagcttggttttgaaggatataaaaatattcataagcttagttatgatgttgcaaaatat
attgctaaagaaattaaggatatgggtatctttgatattattcatgctggtaaaggtggt
atcccagcagtgagttggtcacttaaggcaggcaaaagttatgatttgtttgatatctct
gaaaaaattcgtgctagaggttggcagatagctgcttattcgatgccaaaagatagacaa
gacttggtagttatgcgagtgcttgttaggagaggctttagctttgatttagcggagctt
atgattagggatctaaaaaatgttattaattctttagataataaatctaaagatatcgaa
agaggtggtttttcgcattag

DBGET integrated database retrieval system