KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0916Help
Entry
Fphi_0916         CDS       T00652                                 

Definition
(GenBank) Glu-tRNAGln amidotransferase B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00970  Aminoacyl-tRNA biosynthesis
fph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fph00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Fphi_0916
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fph03029]
    Fphi_0916
Enzymes [BR:fph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Fphi_0916
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Fphi_0916
Mitochondrial biogenesis [BR:fph03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Fphi_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ABZ87139
UniProt: B0TWN1
LinkDB All DBs
Position
986444..987853
Genome map
AA seq 469 aa AA seqDB search
MVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLPGTLPVVNKEAIRKAVIFGL
AVDAKISKDSFFARKNYFYPDLPKGYQISQSNNPIVQEGKLEIETSSGAKTIRIERAHLE
EDAGKSVHGYVAGETGLDYNRAGTPLLEIVTYPDFRSSEEVVSYLKKLHQLVKHLGICDG
NMQEGSFRCDVNLSIRPQGQDKFGTRAELKNINSFRFIDKAIEYEYARQIAVLESGGEVV
QETRLYDADANETRSMRAKEDAFDYRYFPDPDLLPLIITDEYIESIKKQMPLKPEEREAV
YREHLADQEVEFLLSNLEIADYYDQVAAVIGYKPAYNWITVDLISTLNRAEKEFSVDIIP
AEILLEIIDNVQKDVISQANAKKVIAEYIESATSVANIIEKLGLKQVSDESAIRELVQGI
IVANPQQAADFKAGKIKLMSFFVGQAMKASKGKANPKQVNQIVQEELNK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggtgatagggctagaggtccatattcagttaagtactaaatctaagctgttttcgact
tctgcaacaaaatatgggcagcatcaaaatactcaggctgcatttttagatttaggtttg
ccaggaactttgcctgtagtaaataaagaagctattcgtaaagctgttatatttggttta
gctgtagatgctaaaatatcaaaagatagtttcttcgcacgtaagaattacttttatcca
gatttaccaaaaggctaccagattagtcaatctaataatccaatagtccaagagggtaag
ctagagattgaaacttctagtggagctaaaactatcagaattgagcgagctcatctagaa
gaagatgctggtaaatcagttcatggttatgtcgctggtgagacagggttggattataac
cgtgcaggtacaccacttttagaaattgttacatatcctgattttaggtcatctgaagaa
gtagtttcttatcttaaaaagcttcatcagctagtcaagcatttgggtatatgtgatggt
aatatgcaagaaggctcgtttagatgtgatgtcaacttgtcaattagaccacaaggtcaa
gataagtttggtactcgtgcagaacttaaaaacataaactcgtttagatttattgataaa
gcgattgagtatgaatatgctcgtcaaatagctgtgctagagtctggtggagaggttgtt
caagaaactcgtctatatgatgcggatgcaaatgaaacacgctcaatgcgtgcaaaagag
gatgcttttgattatcgttatttcccagatccggatttattaccattgataataactgat
gaatatatcgaaagtatcaaaaagcagatgccacttaagccagaagagcgtgaagcggtc
tatcgtgagcatttagctgatcaagaagttgagtttttattatcaaatcttgaaatagca
gattattatgatcaagtagcagctgtgataggctataagccagcgtataactggataaca
gtcgatttaatatcaactcttaatagagcggaaaaagaattctcagtagatataatccca
gcagagattctattagagattattgataatgtccaaaaagatgttatctcacaagcgaat
gctaaaaaagtcatagcagaatatattgagtcagcaacatctgttgctaatatcatcgag
aaactaggtttgaaacaagtatcagatgagagcgcaataagagaactagttcaaggtata
attgtagctaatcctcaacaggctgctgactttaaggctggtaagattaagcttatgagc
ttctttgttggtcaagctatgaaggcaagtaaaggtaaggcgaatcctaagcaggttaat
caaattgttcaagaagagcttaataaataa

DBGET integrated database retrieval system