KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_1460Help
Entry
Fphi_1460         CDS       T00652                                 

Definition
(GenBank) enoyl-ACP reductase I
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00061  Fatty acid biosynthesis
fph00780  Biotin metabolism
fph01100  Metabolic pathways
fph01130  Biosynthesis of antibiotics
fph01212  Fatty acid metabolism
Module
fph_M00083  Fatty acid biosynthesis, elongation
fph_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:fph00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Fphi_1460
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Fphi_1460
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Fphi_1460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fph01004]
    Fphi_1460
Enzymes [BR:fph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Fphi_1460
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Fphi_1460
Lipid biosynthesis proteins [BR:fph01004]
 Fatty acid synthase
  Component type
   Fphi_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: ABZ87685
UniProt: B0TYT9
LinkDB All DBs
Position
1588512..1589294
Genome map
AA seq 260 aa AA seqDB search
MGFLAGKKILVTGLLSNKSIAYGIAKALHREGAELAFTYVGQFKERVEKLSEEFNPAAIL
PCDVTSDQEMKDLFVELGKVWDGLDGLIHSIAFAPRDQLGGDFIDTVTREGFAIAHDISA
YSFAALAREGRAMMKGRNASIVGLTYIGAEKAMPSYNTMGVAKASLEATMRYTALALGPD
GINVNCVSAGPIKTLAASGIANFKKMLDYNATVSPLKKNVDIMEVGNTVAFLCSDMASGI
TGENIHVDAGYHSVLMGNVL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggttttttagcaggaaagaagatactagttactggtctgttaagcaataaatcaatc
gcttacggtattgcaaaagctcttcatagagaaggtgcagaacttgcgtttacttatgtt
ggtcaattcaaagaaagagtagagaagctaagtgaagagttcaatccagctgcaatttta
ccttgtgatgtaacttctgatcaagagatgaaagacttgtttgttgagctaggtaaagtt
tgggatggtctagatggtcttattcattctatcgcttttgctcctcgtgatcagttaggt
ggcgattttatagatacagttactcgtgaaggtttcgctattgctcatgatatcagtgct
tactcttttgctgccttagctagagaaggtcgtgcgatgatgaagggaagaaatgcttct
atcgtaggtcttacatatattggtgctgaaaaagctatgcctagttataatactatgggt
gttgctaaggcatctttagaagctactatgagatatacagctcttgcattaggtccggat
ggaattaatgttaactgtgtttcagctggtccaatcaaaactttggcagcttcaggtatt
gctaatttcaaaaagatgttggattacaatgctacagtatcaccacttaagaaaaacgtt
gatattatggaagttggtaatacagttgcattcttatgttctgatatggcttctggtatt
actggcgaaaatattcacgttgatgctggttatcatagcgttttaatgggtaatgttctt
taa

DBGET integrated database retrieval system