KEGG   Francisella philomiragia O#319-029: BF30_1196Help
Entry
BF30_1196         CDS       T03617                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
fpi  Francisella philomiragia O#319-029
Brite
Enzymes [BR:fpi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BF30_1196 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJI48130
UniProt: A0A0E2ZZ98
LinkDB All DBs
Position
1206410..1206988
Genome map
AA seq 192 aa AA seqDB search
MKFELPKLPYAFDALEPTISKETIEYHYGKHHQAYVTNLNNLIEGTEHAGKNLEEIIKTS
SGGIFNNAAQVYNHTFYWNCLSPVKTEPSSELKAAIIETFGSIDNFKDQFSKAAVATFGS
GWAWLVKNTEGKLEIVTTSNAGCPLTDNKKPLLTFDVWEHAYYIDYRNARPKYVESLWDI
VNWKFVSEQFKK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaattaccaaaactaccttatgcatttgatgcattagagcctactatttca
aaagaaacgattgagtatcattatggtaagcaccatcaagcttatgtaactaatctaaac
aatctgattgaaggtacagagcatgctggtaaaaatttagaagaaataataaaaacttct
tcaggcggtatatttaataatgctgctcaagtatataatcacacattttattggaattgc
ctgtcaccagttaaaactgaaccatcaagcgagttaaaagcagcgattattgaaactttt
ggttcaatagataactttaaggatcaattctcgaaagcggctgtagctacatttggatct
ggttgggcttggctggtaaaaaataccgaaggcaaacttgagattgttactactagtaat
gcaggctgccctttgacggataacaaaaaacctttacttacatttgatgtttgggagcat
gcttattatattgattatcgtaatgcaagacctaaatatgttgagtctttatgggatata
gtaaattggaaatttgtttctgagcagtttaagaaatag

DBGET integrated database retrieval system