KEGG   Francisella philomiragia O#319-029: BF30_1892Help
Entry
BF30_1892         CDS       T03617                                 

Definition
(GenBank) ribonucleotide reductase, small chain family protein
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
K03676  glutaredoxin 3
Organism
fpi  Francisella philomiragia O#319-029
Pathway
fpi00230  Purine metabolism
fpi00240  Pyrimidine metabolism
fpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BF30_1892
   00240 Pyrimidine metabolism
    BF30_1892
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fpi03110]
    BF30_1892
   03400 DNA repair and recombination proteins [BR:fpi03400]
    BF30_1892
Enzymes [BR:fpi01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     BF30_1892
Chaperones and folding catalysts [BR:fpi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   BF30_1892
DNA repair and recombination proteins [BR:fpi03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BF30_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm Glutaredoxin DUF2391
Motif
Other DBs
NCBI-ProteinID: AJI47992
LinkDB All DBs
Position
complement(1914110..1915342)
Genome map
AA seq 410 aa AA seqDB search
MVEVKIYTKTNCPFCDLAKSWFGTNDIPFTQITLDDDQERLNFYAEVNKNILLVEEHIKS
VPQIFIGDVPIGGYDNLMARAGEVIARVKGSSLTTFSKTYKPFSYPWAVDLTVKHEKAHW
IEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVAVGQNYYDQFIPLFKNNEVRN
MLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDANPNTRRGLGLC
LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQEN
PYIVDNQFKKEIYLMASKAVELEDKFIDLAYEIGTIEGLKADEVKEYIRHITDRRLNQLG
LNEIYNIDKNPLTWLEWILNGADHTNFFENRVTEYEVAGLTGNWDEAYQH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggtggaagtaaaaatatatacaaaaacgaactgccctttttgcgaccttgctaaaagc
tggtttggcactaatgatattccttttacacaaattactcttgatgatgatcaagaaaga
ttaaatttctatgctgaagtaaacaagaatattcttcttgttgaagagcatattaagtct
gttccacagatatttattggcgatgttcctataggtggctatgataaccttatggctaga
gctggcgaggttatcgctcgtgttaaaggttcatcattaacaaccttttcaaaaacatat
aagccatttagctacccttgggctgttgatctaaccgtcaaacatgaaaaagctcactgg
atagaagatgagattgatttgtcagaagatgttactgattggaaaaacggtaaaatcact
aaagttgaaaaagagtatattactaatatcctaagactatttactcaatctgatgtagcc
gttggtcaaaattactatgatcagtttataccattgttcaaaaataatgaagttagaaat
atgcttggctcctttgctgctcgtgaaggtattcatcaaagagcatacgcacttctaaat
gatactcttggtcttcctgactctgaataccatgctttcttagagtataaggcaatgaca
gataaaattgactttatgatggatgctaatcctaatactcgtcgtggtttgggattgtgt
cttgctaagacagtatttaatgaaggtgtagccttatttgcatcatttgcaatgttactt
aacttccaacgctttggtaaaatgaaaggtatgggtaaagtcgttgagtggtcaatccgt
gatgaatctatgcacgtcgaaggtaatgctgcattatttagaatatactgccaagaaaat
ccatatatagttgataatcaatttaaaaaagaaatatatctaatggctagcaaggctgtt
gagcttgaagataaatttattgatttagcttatgagatcggtactatcgaaggtctaaaa
gctgatgaagtaaaagaatatattcgtcatattacagatagacgtttaaatcagcttggt
ttgaatgaaatatataatattgataaaaatcctcttacttggttggagtggatcttaaat
ggtgctgatcatacaaacttctttgaaaaccgtgtgactgaatatgaggttgcaggtcta
actggtaactgggatgaggcttaccagcattaa

DBGET integrated database retrieval system