KEGG   Francisella philomiragia O#319-029: BF30_355Help
Entry
BF30_355          CDS       T03617                                 

Gene name
cydC
Definition
(GenBank) thiol reductant ABC exporter, CydC subunit
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
fpi  Francisella philomiragia O#319-029
Pathway
fpi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:fpi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BF30_355 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fpi02000]
    BF30_355 (cydC)
Transporters [BR:fpi02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BF30_355 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_21 DUF87 AAA_22 SapB_1
Motif
Other DBs
NCBI-ProteinID: AJI46608
LinkDB All DBs
Position
352420..354069
Genome map
AA seq 549 aa AA seqDB search
MRNLIPFIKLFKNQTQWMLLGTLLAWSAILMGIGLMSLSGWFISYTGYLATTTYAIATSF
NYFYPSAGVRSFSLGRILSRYGERILTHEATFRIITDIRVWFYQKLEPLAPSHLYKYKSG
DLLTRLVNDIGALDNLYIRIISPTVVFVLASITIAILFSFFSLSLALLTFIALLLIGFVI
PLVSSLLAMKKTQDLNHTSAKLKTNITEHVNSLAELKIFDLDGKHLENIKRQNSELLNQE
EKISFISGFGSALMTLALGLTVVMVTVFAVKLTQNGYISGAFIALIFLAIMAMFESIMPL
PLAYQYLGKTLSASKRILNITDAKADVEYPTNSDISLDNYSICFNNVDFGYNAEQSVLKD
FCLKIKQNEKIALFAPTGKGKSTIINLLARFWDVNSGEITIGDRNIKEFNEDQLRKLMTV
INQSPHIFNTTIRENLKIPKDNATEEELLEALEKVELRKHVESLPKGLDTWTGELGRQLS
GGQQKRLALARAFLQDKPILILDEPTEGLDKETERLVFENLVELMQNKTVIFITHNAKLL
ESFDRVIKL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttaataccatttataaagctgtttaaaaatcaaactcaatggatgctcttg
ggtaccctacttgcatggtcagcaatacttatgggtataggattaatgtcactatctggt
tggtttatctcatatactggttatttagctactactacctatgctattgcaacttcattt
aactatttttacccttctgctggtgtacgctctttctcacttggtaggatactaagtaga
tatggcgaaagaatactaacacacgaagcaacttttagaataattacagatattcgtgtc
tggttctatcaaaagcttgaaccacttgcgccttctcatttgtacaaatataaaagtggc
gacttacttacacgtctagtcaatgatattggtgcattagataatctatatattcgtata
atttccccaactgttgtctttgtcttagcaagtataactatagctatattatttagtttc
tttagtttaagccttgcactacttacatttatagcactgttgctaatagggtttgtaata
ccgttagttagtagtctattagccatgaaaaaaacccaagatcttaatcacactagtgct
aaattaaaaacaaatatcacagaacatgttaactctctagcagagcttaaaatctttgac
ttagatggtaagcatctagaaaacattaaaaggcaaaattctgaactactaaaccaagaa
gaaaaaatcagttttataagtggttttggtagtgctttaatgactttggcattaggctta
actgtagttatggtaacagtctttgcagtcaaactaactcaaaatggctatataagtggt
gcatttattgctctgatattcttggcgataatggcgatgtttgagtcaattatgccatta
ccactagcatatcagtatttaggtaagacactttctgcttcaaaaaggatattaaatatt
acagatgctaaagcagatgttgagtatccaacaaactctgacattagcttagataactat
agcatctgcttcaataatgttgattttggctataatgcagagcaatcagtacttaaagat
ttttgtttaaaaatcaaacaaaatgaaaaaatagcactattcgcaccaacaggaaaaggc
aaatctactattattaatctgcttgctagattctgggatgttaatagtggtgaaatcact
atcggtgatagaaatatcaaggaatttaacgaagatcagcttagaaaattaatgactgta
attaatcagtctccacatatctttaatactacgattagagaaaatctgaagattcctaag
gataatgctactgaagaagagctactagaagccttagaaaaagttgaattaagaaaacat
gttgagtcactaccaaaaggactggatacttggactggtgagcttggtagacaattatca
ggcggtcaacaaaaacgcctagctttagcgcgtgcattcttacaagataaacctatactt
atcctagatgagccaactgaaggacttgataaagaaacggaaagattagtttttgaaaac
ttagttgagcttatgcaaaataagactgtaatttttattactcataatgctaagcttttg
gaaagttttgatagagttattaagctttaa

DBGET integrated database retrieval system