KEGG   Francisella philomiragia GA01-2801: LA02_349Help
Entry
LA02_349          CDS       T03621                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fpj  Francisella philomiragia GA01-2801
Pathway
fpj00250  Alanine, aspartate and glutamate metabolism
fpj00410  beta-Alanine metabolism
fpj00430  Taurine and hypotaurine metabolism
fpj00650  Butanoate metabolism
fpj01100  Metabolic pathways
fpj01110  Biosynthesis of secondary metabolites
fpj01120  Microbial metabolism in diverse environments
fpj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LA02_349
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LA02_349
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LA02_349
   00430 Taurine and hypotaurine metabolism
    LA02_349
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LA02_349
Enzymes [BR:fpj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LA02_349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJI57942
UniProt: A0A0E1N8W3
LinkDB All DBs
Position
complement(318110..319450)
Genome map
AA seq 446 aa AA seqDB search
MALHAKNDMKHKFYKESLPKFEIPKKSNDAFEAYQQIKDELMLDGNSKQNLATFCQTEVD
DFIHRLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAAML
GGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSSESLIMTPE
TMLKYCDENTIGVVPTLGVTFTGQYEPVEAVCEALDKFERDTGIDIPVHVDAASGGFLAP
FVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVVWADKKYLPQDLIFNVNYLGGDMPT
FALNFSRPGGQIVAQYYNFVKLGFEGYKNIHKLSYDVAKYIAKEIKDMGIFDIIHAGKGG
IPAVSWSLKAGKSYDLFDISEKIRARGWQIAAYSMPKDRQDLVVMRVLVRRGFSFDLAEL
MIRDLKNVINSLDNKSKDIERGGFSH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcgttacatgccaaaaatgatatgaaacataagttttataaagaatcattaccaaaa
tttgaaattcccaaaaaatcaaatgatgctttcgaagcatatcaacagattaaagatgag
ctaatgctcgatggtaattcaaagcagaatttagcgacattttgtcaaacagaagttgat
gatttcattcataggcttatggatgattgcattgataagaatatgattgataaagatgag
tatcctcaaactgctgaaatagagtcacgatgtgtcaacatactagcaaacctatggaac
tcttcagcagaaaatgcaatcggctgttcaactactggctcatctgaagcagctatgctt
ggcggtatggcaatgaagtggcgctggcgtgataagatgaaagctcaaggtaaagattat
acaaaacctaatcttgttacgggacctgtgcaagtctgctggcataaattcgctagatat
tgggatattgagcttagagagattccaatgtcgagtgaaagtttaataatgactccagaa
actatgcttaagtactgtgatgaaaatacaattggagttgtgcctactttgggggttacc
tttacaggtcagtacgagcctgttgaggcagtttgtgaagcacttgataaatttgagaga
gatactggtattgatattccagtgcatgtagatgctgcttctggaggatttttggcacca
tttgtagagcctgaacttaagtgggattttagattaccaagagttaagtcaattaattca
tcaggacataagtttgggttatcgccattaggagtgggttgggttgtttgggcagataag
aaatacttacctcaagatttgatttttaatgttaattatcttggtggcgatatgccgaca
tttgctttgaatttctctcgacctggtggtcagatagttgcccagtattataactttgtt
aagcttggttttgaaggatataaaaatattcataagcttagttatgatgttgcaaaatat
attgctaaagaaattaaggatatgggtatctttgatattattcatgctggtaaaggtggt
atcccagcagtgagttggtcacttaaggcaggcaaaagttatgatttgtttgatatctct
gaaaaaattcgtgctagaggttggcagatagctgcttattcgatgccaaaagatagacaa
gacttggtagttatgcgagtgcttgttaggagaggctttagctttgatttagcggagctt
atgattagggatctaaaaaatgttattaattctttagataataaatctaaagatatcgaa
agaggtggtttttcgcattag

DBGET integrated database retrieval system