KEGG   Flavobacterium psychrophilum v4-33: IA06_01030Help
Entry
IA06_01030        CDS       T03661                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
fpk  Flavobacterium psychrophilum v4-33
Brite
KEGG Orthology (KO) [BR:fpk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    IA06_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: AIG40480
LinkDB All DBs
Position
230432..231910
Genome map
AA seq 492 aa AA seqDB search
MSIWKKKSISLLLAEASESEKGLKRTLTAWSLVALGVGAIIGAGLFVRTATAAAQNAGPS
VTIAFIIAAIGCALAGLCYAELSSSIPISGSAYTYTYATMGELLAWIIGWDLILEYAVGA
ATVGIAWSEYLNNLLVNVLHTSPIPYSLSHSPFQISASGEHGIINLPAFFIVAVISLLLI
KGTQESAFVNGIIVLVKVSIVIMIIVFGWNFINPINHTPYIPQPSIFIDDSGVGHNYGGI
MGILGAAGTVFFAFIGFDAVSTAAQETKNPKRDMPIGILGSLAVCTVLYILFAHVLTGLE
SVEFFRTSGKEASVANVITTAMVGYEWLAQFVTVAILFGFTSVILVMLLGQSRVFYAMGK
DGLLPKAFGDLHSKYKTPYKANLVILVIVGAFAAFVPGDIVGDMTSIGTLFAFILVCVSV
IVLRKTDPDMKREFKTPFVPFVPILGVIVCLAMIYGLGWTNWLRLAVWLAIGLIVYFGYS
KKNSVLNNPDKK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttggaaaaaaaaatcaatatctcttttgcttgcagaagcatctgagtctgag
aaaggtttaaaaagaacactaaccgcttggtcgcttgtcgcattaggagttggcgcaatt
ataggagctggtctttttgttagaaccgcaacggcggctgcccaaaacgctgggccatca
gtaacaatcgcatttattatagcagctattggctgtgctttggcagggctttgttatgca
gaattgtcttcatctattccaatttcaggaagcgcatatacttatacttatgcaacaatg
ggagagcttttagcttggataattggttgggatttaatactagagtatgccgtaggggct
gccactgttgggatcgcttggagtgagtatctaaataacttgctggtaaatgtgcttcat
actagtcctataccttattctttatcacattcgccttttcaaatttctgcatcaggagaa
catggtataataaaccttcctgccttctttattgtagcagtaataagtttgttgctaatt
aaaggaacacaagaatctgcatttgtaaatggtatcattgtacttgtaaaagtatctatt
gtaataatgattattgtatttggttggaattttataaacccaataaatcatactccttat
ataccacagccttcaatatttatagatgactcaggtgtgggacataattacggaggaatc
atgggtattttaggagcagcaggaacagtattttttgcttttatcggatttgatgcagtt
agtacagcggcacaagaaactaaaaacccaaaaagagatatgccaattggtattttaggc
tcattagctgtttgtactgttttgtatattctttttgcacacgttttaactggacttgaa
tctgtagaattttttagaacaagcggaaaagaagcatcggttgcaaatgtaattaccact
gcaatggttggttacgagtggttagcccagtttgtaacagtagctattttatttggattt
acctcggtaattttagtaatgttactaggtcaatctagggttttttacgctatgggtaaa
gatggtttattgccaaaagcattcggagacttacattctaaatacaaaacaccatacaaa
gcaaaccttgtcattttagtaattgttggtgcatttgctgcttttgttccgggagatata
gtaggagatatgactagtataggtactttatttgcatttattttagtttgtgtttctgta
attgtattaagaaaaacagatccagatatgaaacgcgaattcaaaactccattcgtacca
tttgtgccaattttaggtgtaatagtttgtttagcaatgatatacggtcttggctggaca
aactggttaagacttgcagtttggctagcaataggacttattgtatatttcgggtatagt
aaaaaaaatagcgttttaaacaatcctgataaaaaataa

DBGET integrated database retrieval system