KEGG   Flavobacterium psychrophilum v4-33: IA06_04980Help
Entry
IA06_04980        CDS       T03661                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fpk  Flavobacterium psychrophilum v4-33
Pathway
fpk00240  Pyrimidine metabolism
fpk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    IA06_04980
Enzymes [BR:fpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     IA06_04980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AIG41198
UniProt: A0A076P3W9
LinkDB All DBs
Position
1103745..1104353
Genome map
AA seq 202 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPTIDTRYDDEM
VVSHNKNEIRSTPVPAAANIAILAQGCDVVGIDEAQFFDDEIVKICNDLANSGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKTDNDKLVMLGETEEYEP
LSRAAYYNAMRENMIVKDAEHL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagagcagtttggttggattgaagttatttgc
ggatcgatgttttcgggtaaaaccgaggagttaattcgtagattaaaaagagcacaattt
gccaaacaaaaagtcgaaatttttaaacccactatcgataccagatatgatgacgaaatg
gtggtttcgcataacaaaaacgaaattagatctacgcctgttcccgcagctgcaaacatt
gccattttagcccaaggttgcgatgttgttgggattgatgaggcgcaattttttgatgac
gagattgtaaaaatttgtaatgaccttgccaattcaggcattagagttattgtggctgga
ttggatatggattttaaaggaaatccttttggccccatgccagcacttatggcaacggca
gaatatgttacaaaagtacacgccgtttgtacccgtacaggaaatttggccaattatagt
tttcgcaaaaccgataatgacaaactcgttatgcttggcgaaaccgaagaatacgaaccc
ttaagtcgtgccgcatattataatgccatgagagaaaatatgattgtaaaagatgctgaa
catttataa

DBGET integrated database retrieval system