KEGG   Ferroglobus placidus: Ferp_0965Help
Entry
Ferp_0965         CDS       T01172                                 

Definition
(GenBank) phosphate ABC transporter, ATPase subunit
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
fpl  Ferroglobus placidus
Pathway
fpl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:fpl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Ferp_0965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fpl02000]
    Ferp_0965
Enzymes [BR:fpl01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Ferp_0965
Transporters [BR:fpl02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Ferp_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 RsgA_GTPase AAA_23 AAA_29 AAA_24 PRK AAA_22 Rad17 AAA_18 AAA_16 RNA_helicase Adeno_IVa2 AAA_30 AAA_25 NACHT ATPase_2 AAA_33 AAA_14 AAA AAA_28 AAA_5
Motif
Other DBs
NCBI-ProteinID: ADC65129
UniProt: D3RXB6
LinkDB All DBs
Position
841135..841887
Genome map
AA seq 250 aa AA seqDB search
MIVFDVKNLSVYYGDKVGIQDVNIEIYKNKVTAIMGPSGCGKSTFLRSLNRLIELVENVR
VEGKVLFEGKNIYDPDVDPVELRKRIGMVFQHPNPFPKSIFDNVAFGPRIHGIKDKKKLE
KIVEDALKKAALWDEVKDRLHDSALRLSGGQQQRLCIARAIATNPEVILFDEPTASLDPI
AASKIEDLIVDLKKSYTVVVVTHNIQQAARISDYVAFFWMGKLVEYGKTEEVFENPQNEL
TEKYLTGRIG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgatagtattcgacgtcaaaaacctgagcgtgtattatggcgataaagtcggaattcag
gacgtgaacatcgagatttacaaaaataaggtgacagcaataatgggtccgagcggctgc
ggaaagtccacctttttgaggtctctaaacagattgatagagcttgtggaaaacgtcaga
gttgagggaaaggttttgttcgaaggaaagaacatctacgacccagacgttgatccggtt
gagctgagaaagagaatagggatggttttccagcatccaaacccatttccaaagagcata
ttcgacaacgtagccttcggaccgagaattcacggtataaaagacaagaaaaaactcgaa
aagatagttgaagacgctttgaagaaagctgcgctatgggatgaagtcaaggacagactc
cacgattcggctttgaggctcagcggaggacagcagcagaggctttgcatagcgagagct
attgctacgaatcccgaggtgattctcttcgacgagcccacagcctctctcgatccgata
gccgcttcgaaaatagaggaccttatagtggatttgaagaagagctatacagttgtcgtc
gttactcacaacattcagcaggcagcgagaataagcgactacgtagctttcttctggatg
ggaaagcttgttgagtacggaaaaacggaagaagtctttgaaaatccgcagaacgagctt
acagagaagtacttgacgggaagaataggatga

DBGET integrated database retrieval system