KEGG   Ferroglobus placidus: Ferp_1330Help
Entry
Ferp_1330         CDS       T01172                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
fpl  Ferroglobus placidus
Brite
KEGG Orthology (KO) [BR:fpl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ferp_1330
Enzymes [BR:fpl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Ferp_1330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M COG7 Relaxase
Motif
Other DBs
NCBI-ProteinID: ADC65482
UniProt: D3RYB9
LinkDB All DBs
Position
1142849..1143985
Genome map
AA seq 378 aa AA seqDB search
MYVAEALGLSKPAAEKLKEKNVLKEAFIKHPFFPDVIDAVRFDKRFAGLEEGTVVAKTIH
GVEVVHGFPKIRRALTLYPTIKLHFKGEIVFEEKMNGYNVRIVMFGKNLYALTRRGFICP
YTTEKARELINESFFKDYPNLMLCCEAVGRYSPYVPKDVYGVDFDFYVFDVREKRSGKPL
PVKEKEKICEEYGLNLAPILAQCKAEEGHVVGRRVVEELEGSGREGVVIKDVNMVVEPIK
YTTSETNCNDLSYAFRYFNEYGKDFMFSRIVREGFQSFEFDDEEKFRERCFRLGKAILES
LVKSIKDVSEGRRVVERVELIFSSFETFELFTEHLKRSGVNFEVVELKKRGGKVHAVIDR
VMKSTTDKIKSHLGGALW
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttgccgaagctttaggcttgagcaagccagctgcagaaaaattaaaggagaaa
aacgttttaaaagaggctttcatcaaacatccttttttccccgacgtgattgatgcggta
aggttcgataagaggtttgccgggcttgaggaggggacggtcgttgctaaaactattcac
ggagttgaagtagttcacggctttcctaaaatcaggagagccctaactctttatcccacg
atcaaacttcatttcaaaggagaaattgttttcgaggaaaaaatgaacggttacaacgtg
agaatcgttatgttcggaaaaaatctgtacgctttaacgaggaggggttttatttgcccc
tacacaacggagaaagcaagggagctaattaacgagtctttttttaaagattacccgaac
ctcatgctctgctgcgaagcagtgggaaggtactccccatacgttccgaaagatgtttac
ggggtggatttcgacttttacgttttcgatgtaagggagaagaggagtggaaagcctttg
ccagtcaaagaaaaggagaaaatctgcgaggaatacggactcaacttagctccaattctc
gctcaatgcaaagctgaagaagggcatgttgtcgggagaagagttgttgaggagttggaa
ggaagcggtagggagggagttgtaataaaagacgtaaacatggtagttgagccgataaag
tacacgacaagcgaaacaaattgcaacgacctaagctacgctttcagatatttcaacgag
tacggaaaggacttcatgttctcgagaatcgtcagagaaggctttcaaagcttcgaattc
gacgatgaggaaaagtttagggagaggtgcttcaggctggggaaggcgatactcgaaagc
ttggtgaagagcattaaggacgttagcgaagggagaagggtcgtcgaaagggtggaatta
attttttcctcctttgaaacctttgagctatttacggagcatttaaagaggagcggagtt
aattttgaagttgttgagctgaaaaagaggggaggaaaagttcacgcagtaattgacagg
gtgatgaagagcactacggataaaataaagagtcacctcggtggagctttatggtaa

DBGET integrated database retrieval system