KEGG   Ferroglobus placidus: Ferp_2060Help
Entry
Ferp_2060         CDS       T01172                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fpl  Ferroglobus placidus
Pathway
fpl00620  Pyruvate metabolism
fpl00680  Methane metabolism
fpl00720  Carbon fixation pathways in prokaryotes
fpl01100  Metabolic pathways
fpl01120  Microbial metabolism in diverse environments
fpl01200  Carbon metabolism
Module
fpl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ferp_2060
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ferp_2060
   00680 Methane metabolism
    Ferp_2060
Enzymes [BR:fpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Ferp_2060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADC66194
UniProt: D3S0D1
LinkDB All DBs
Position
complement(1773673..1775103)
Genome map
AA seq 476 aa AA seqDB search
MVPRVMSTQHPDNANVPFFARGEYLNGEDEVKEAYYVFSHFGCDEQMWDFEGKEVDDFVV
RKLLSNYPDFFKKKPLGKCFRLTPRIPNPSVEKEEAKLLSEILEMIPRSYDYVKSFDIDH
EPIFEVILPMTRTHEEVLRIYYFYKDFVAGKGKLSLRDGTKISEWLGEFKPEEIKVIPLL
EDKNSLLNAEKIVSKIVEETGSENIRVFLARSDPALNYGFVSATIYVKYALMRLEDVNAE
VYPILGVGSCPFRGGLSPKNLQPVDEFPSVETFTVQSAFKYDYEFSEVRKAVERIKEKRR
GKAEVIDEEHLKVAEKLTEAYRMRIPLIANFVNSFSKNIPRRRMRKLHIGLFGYSRGEGV
KLPRAITFCAALYSIGFPPELLGIAELSDKDYEVVTEVFRGFENMMREALKYFNPNSLKV
LNSKLEKDVERAKELFEIEVDEEHEKVTNEIINTLGKGLDLKERVAEAGILRGFLG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggttccgagggtaatgagcacgcagcacccagataatgcaaacgtgcctttctttgcc
agaggagagtacttaaacggagaggatgaagtaaaggaggcgtattacgtcttctctcac
ttcggctgcgatgaacagatgtgggattttgagggaaaagaggttgacgacttcgtcgtt
agaaagctcctctcgaattatccagactttttcaaaaagaaacctctcggaaagtgcttc
aggttaactccgagaatcccaaacccgagcgttgaaaaagaagaggcgaagcttttatcg
gaaattctggagatgattccgagaagctacgactacgtgaaatccttcgacatcgatcat
gagccgattttcgaagttatcttgccgatgacgagaactcacgaagaagttctgagaatc
tactacttttacaaggacttcgttgctggaaagggaaagctgagtttgagagacggaacg
aagatatccgaatggctcggtgagtttaagccggaagaaattaaagttatacctctctta
gaagacaaaaattcgctactgaacgctgaaaaaatcgttagcaagatcgttgaagagact
ggtagcgaaaacatccgagtgtttttagcgagatccgatccggctttaaactacggtttc
gtttccgcgacgatctacgtaaaatacgctctcatgcgcttggaagacgttaacgccgaa
gtttatccgatactcggcgtaggctcttgtcctttcaggggaggactttcaccaaagaat
ctacagccagtggatgaatttccttcagtagagacattcacagtacaatcagcttttaag
tacgattacgaattttctgaagttagaaaagccgtagagaggataaaggaaaagaggaga
ggaaaagccgaggtaatcgacgaggagcatttaaaagtggctgaaaaactaacagaagct
tacagaatgagaattccgctcatagctaacttcgtaaactctttctcgaaaaacattccg
aggagaagaatgagaaagcttcacatcggtctcttcggttactcgagaggggaaggagtt
aaacttccgagggcgattacgttctgcgcggctctttactccataggttttccgccggag
ttgctcgggatagctgaactcagcgataaagattacgaagtagttacggaagtttttaga
ggctttgaaaatatgatgagagaagcattgaaatatttcaatccgaattctttgaaagtg
ctgaattcgaagcttgaaaaggatgtggaaagggctaaagagctgtttgaaatcgaagtt
gacgaggagcacgaaaaagttactaacgaaatcataaacacgctcggtaaaggtttggac
ttaaaagagagggtcgccgaggcaggaattttgaggggttttcttgggtaa

DBGET integrated database retrieval system