KEGG   Flavonifractor plautii: A4U99_04395Help
Entry
A4U99_04395       CDS       T04429                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
fpla  Flavonifractor plautii
Pathway
fpla00040  Pentose and glucuronate interconversions
fpla00051  Fructose and mannose metabolism
fpla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A4U99_04395
   00051 Fructose and mannose metabolism
    A4U99_04395
Enzymes [BR:fpla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     A4U99_04395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C TrkA_N Shikimate_DH NADH_4Fe-4S F420_oxidored Pyr_redox ThiF 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ANU40353
UniProt: A0A1C7FK56
LinkDB All DBs
Position
931863..932897
Genome map
AA seq 344 aa AA seqDB search
MLQQVMTAPGVIEFREVPIPEPKAGEVLVKIMRIGVCGSDIHVYHGEHPFTKYPVTQGHE
VSGEIAALGKGVTSLRVGQRVTIEPQVVCGRCYPCRHGKYNLCEELKVMGFQSTGTASEF
FAVDAAKITPLPDTMSFNEGAMIEPLAVAVHAAKRFPELAGAKVAILGSGPIGILLAQSC
KALGAAQVLITDISDARLELARSCGADFAVNTRIRNFGEVMVECFGPDKADVIYDCAGND
TTMGQAIQYARKGSKLVLVAVYAGMAHVDLALLNDHELDLDSTMMYRHEDYVDAIRLVSE
GKIQLKPLMSRHFAFGDYQKAYEYIDANREATMKVLIDVAPCEE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagcaggttatgacagccccgggggtcattgaattccgggaggttccaatccct
gagccaaaggccggtgaggtactggtcaaaatcatgcgcatcggcgtgtgcggctcggat
atccatgtctatcacggtgaacacccgtttacgaaatatcccgtcacccaaggccacgag
gtgtcgggggagattgccgcgcttggaaagggagtcaccagcctccgggtgggacagcgt
gtcaccatcgagccacaggtggtatgcggcaggtgctacccctgccgccatggcaaatac
aatctctgcgaggaactcaaggtgatggggttccagagcactggtaccgccagcgaattt
tttgcggtggatgcggctaagattactccgcttcccgacacaatgagttttaatgaaggg
gctatgatcgagccgctggctgtggccgttcatgcagctaaacgctttccggagctggcg
ggcgccaaagtggccattttgggttccggccccatcggtattctgctggcccagagctgc
aaggctctgggggcggcccaggtgctcattaccgatatctccgacgcccggctggagctg
gcccggagctgtggggcggacttcgcagtgaacactcggatacgtaattttggtgaagtc
atggtagagtgcttcggtccggacaaggcggatgttatttacgactgcgcaggcaacgat
accaccatgggacaggctatccagtatgcccgcaagggcagcaagctggttctggtcgca
gtatatgcaggaatggcccatgtggatctggccctgcttaatgaccacgagctggatctg
gacagcaccatgatgtaccggcatgaggactatgtggatgccatccgtctggtcagtgag
gggaaaatccagctcaagcccctgatgagccggcactttgccttcggggactatcagaaa
gcctatgaatacatcgatgccaaccgggaagccaccatgaaggtcttgatcgatgtagct
ccttgtgaagaatga

DBGET integrated database retrieval system