KEGG   Flavonifractor plautii: A4U99_08780Help
Entry
A4U99_08780       CDS       T04429                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
fpla  Flavonifractor plautii
Brite
Enzymes [BR:fpla01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A4U99_08780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ANU41158
UniProt: A0A1C7FLY4
LinkDB All DBs
Position
complement(1824035..1824526)
Genome map
AA seq 163 aa AA seqDB search
MEAYSMADALCRLPRVLLDGRPAARALLCGSNAHPGLRGEALFYPYQDGTLLLIRALGLP
GDGFYACHIHALGDCCTGGDVAFHCAGPHYDPEGREHPNHAGDLPVLLSSGGRALSLVYT
GRFQPGQVLGRSVVLHALPDDYRSQPTGAAGGRIACGVISPVA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgtattccatggctgatgctctgtgccgcctgccccgggtcctgctggacggc
cgccctgccgcccgggcgctgctctgcggcagcaacgcccaccccggcctgcggggcgag
gcgctgttttatccctaccaggacggaaccctattgctgatacgcgccctggggctgccc
ggcgacggcttttatgcctgccacattcacgcgctcggcgactgctgcaccgggggcgac
gtggcctttcactgcgccggtccccactacgacccggaaggccgcgagcacccgaaccac
gctggagatctccccgtcctgctctccagcggtggccgggcgctctccctcgtgtatacc
ggccggtttcagcccgggcaggtgctgggccggtcggtggtactccacgctctgcccgac
gactaccgcagtcagcccaccggcgccgccgggggccgcattgcctgcggcgtcatctcc
cctgtggcctaa

DBGET integrated database retrieval system