KEGG   Flavonifractor plautii: A4U99_09220Help
Entry
A4U99_09220       CDS       T04429                                 

Definition
(GenBank) kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fpla  Flavonifractor plautii
Brite
KEGG Orthology (KO) [BR:fpla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpla01001]
    A4U99_09220
Enzymes [BR:fpla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     A4U99_09220
Protein kinases [BR:fpla01001]
 Serine/threonine kinases: Other
  Bacterial family
   A4U99_09220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Seadorna_VP7 Kdo Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ANU41243
UniProt: A0A1C7FMP2
LinkDB All DBs
Position
1910495..1912624
Genome map
AA seq 709 aa AA seqDB search
MDQYIGKLLDNRYEIIERIGTGGMAVVYKGRDHRLNRLVAVKILKEELAQDAEFRRRFHD
ESQAVAMLSHPNIMAVYDVSHSTELDYIVMELIDGITLKQYMQKKGGKLAWREALHFITQ
IMKALSHAHSRGIIHRDIKPHNMMVLRDGSLKVADFGIARLTSAAQATLTQEALGSVHYI
SPEQARGSHIDARSDIYSAGVVLYEMITGRLPYEGESPVAVAIQHINSIPLSPREIDPEI
PEALEAITMKAMASDVNQRYVSADAMLVDLEEFRKNPSINFDYTPADLLIADGDEPTQIL
GANTPHTVRSQPAHASRAASEEPYARPTPKPRKSRAVPLEDEVDYDDYPDRRDGGGSRLP
IILAIAAVAVFVVGIGVFLWVSFFSSPGQTVYNVPNLVGKTIEEARADSGVTVAQFQVVE
GQEVDSTLPKGQIVNQDPQSGRNAAAGTTITVDISNGSGSTDVEENRMPNLVNQDKRLAI
NTLRELGFTEEAGNLVIREETSEDVTKDYVLSTDPVAETDLADVEKVTLVVSSGVKTETS
VIIPFLGMTEQEARAKAEGTLGLVVVFDEPQYSNDYAEGLVCWQSIQTGTEVDKGSTIHL
RLSKGADPSTSPDPEITPTPTPGASTDPEVSPTPGSGGALKPISYTVNLASSDKETVRVR
VTVNGQDQFNEDVQTVLGVRVVTLYGTGFQQVDVYLDGQLSETRMMNFG
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtacatagggaaattactcgacaaccgatatgagatcattgagcgcatcggg
acgggcggtatggccgtggtctacaaggggcgggatcaccgcctcaaccggctggtggcg
gtgaagattctcaaagaggagctggctcaggacgccgagttccgccgccggttccacgat
gagtcccaggccgtcgccatgctctcccatcccaacatcatggcggtctacgatgtgtcc
cactccacggagctggattacatcgttatggagctcatcgacggcatcaccctcaagcag
tatatgcagaagaagggaggcaagctggcctggcgggaggcgctgcacttcatcactcag
atcatgaaggccctctcccacgcccacagccgggggatcatccaccgggatatcaagccc
cacaacatgatggtgttgcgggacggcagcctgaaggtggccgatttcggcatcgcccgg
ctcacctccgccgcccaggccaccctgacccaggaggccctgggctcagtacactatatc
tcgccggagcaggcccgtggcagccatatcgacgcccgcagtgatatctactccgccggt
gtggtactctatgagatgatcaccggccgcctgccctatgagggggagtccccggtggcg
gtggccatccagcacatcaactccattccgctctccccacgggagatcgacccagagatc
ccagaggctctggaggccatcaccatgaaagctatggcctcggatgtcaaccagcgctat
gtatcggcagacgccatgctggtggacctggaggagttccgcaagaatcccagcatcaat
ttcgactatacgcccgccgatctgctcatcgccgacggcgacgaacccactcagattctg
ggcgccaacacgccgcacaccgtgcgttcccagccggcccatgccagccgggccgcgtcg
gaggagccctatgcccgtcccacaccgaagccccgcaaaagccgtgcggttccccttgag
gacgaggtggactatgacgactatccggaccggcgggatgggggcggcagccgtctgccc
attattctggccattgcagcagtggccgtgtttgtagtcggcatcggcgtatttctctgg
gtctccttcttcagcagcccggggcagactgtctacaatgtccctaatctggtgggtaag
accatcgaggaagcgcgggcggacagcggcgtaaccgtggctcaattccaggtcgtagag
ggtcaggaagtggacagcactttacccaaaggacagattgtgaaccaggacccgcaatcg
ggacgcaacgctgcggcgggaaccaccatcactgtcgatatcagcaacggcagcggcagc
accgacgtggaggagaaccggatgcccaacctggtgaaccaggataagcgtctggccatc
aataccctgcgggaactcggcttcaccgaggaagccggtaatctggttatccgggaggag
acctcggaggatgtaaccaaggactatgtgctttccaccgacccggtggcggagaccgat
ctggccgatgtggagaaggtcactcttgtagtcagcagcggtgtcaagacggaaacctct
gttattatcccgttcctcggcatgacagagcaggaggcccgcgctaaggccgagggaacg
ctgggactggtggtcgtatttgacgagcctcagtacagcaatgactacgccgagggtctg
gtctgctggcagtccatccagacgggtactgaggtcgataagggttccaccatccatctg
cgcctgagcaaaggggcagatccctccacctctcccgacccggagatcaccccgactccc
acgccgggggcctctaccgacccggaggtttcccccacaccaggcagcggaggtgcgctg
aagcccatcagctatacggtaaatctggccagctccgacaaggagactgtccgtgtccgg
gtcacagtcaacgggcaggatcagttcaatgaggacgtacagaccgtactaggcgtccgg
gtggtaacactttatggaaccggcttccagcaagtggatgtctatcttgacgggcagctc
tccgagacccgcatgatgaacttcggctga

DBGET integrated database retrieval system