KEGG   Flavonifractor plautii: A4U99_17805Help
Entry
A4U99_17805       CDS       T04429                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
fpla  Flavonifractor plautii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C TrkA_N Methyltransf_25 AlaDh_PNT_C NAD_binding_3 AdoHcyase_NAD NAD_binding_7 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ANU43040
UniProt: A0A1C7FTS0
LinkDB All DBs
Position
3742411..3743445
Genome map
AA seq 344 aa AA seqDB search
MLQEVMTAPREIRFDRVPVPTAGPGQVLVKIKRIGICGSDIHVYHGKHPYTKYPVTQGHE
VSGQVAALGEGVTQFQVGQRVTIEPQVYCGECYPCTHGKYNLCENLKVMGFQTTGIASEY
FAVDASKVTALPVGMSYDEGAMLEPLAVTVHAARRAGDVAGKKVCVLGCGPIGILLVQSL
KAFGAAEVMATDISDYRLELARTCGADYAVNTKTRPFGAALTECFGPDKADIIYDCAGND
TTMDQAIQNARKGSVIILVAVYAGLAHCDLAKLNDSELDLNTTMMYRHEDYVDAIRFVRE
GMVQLQPLMSRHFAFTDYLAAYEYIDTHQETTMKVLIDVDPSDD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggaagtgatgacggcccccagggagatccggtttgacagggtgcccgttccc
acggccgggcccgggcaggtgctggtgaaaatcaagcgcatcggcatctgcggctccgac
atccacgtataccacggcaagcacccctacaccaagtacccggtcacccagggccacgag
gtctccggccaggtcgcggcgctgggggagggagtcacccaattccaggtgggtcagcgg
gtgaccattgaaccccaggtgtactgcggcgaatgctacccctgcacccacggcaagtat
aacctctgcgagaacctgaaggttatgggctttcagaccaccggaattgccagtgaatac
ttcgcggtggacgcctccaaggtgacggcgctgcctgtgggaatgagctatgacgagggc
gccatgctggagcctctggccgtcacggtgcacgccgccaggcgggcgggggacgtagcg
ggcaagaaggtatgcgtgctgggctgcggccctatcggcattctgctggttcaatccctg
aaggcctttggcgcggccgaggtcatggccaccgatatctccgactatcggctggagctg
gcccgcacctgcggagcggattacgctgtcaacaccaaaacccgcccctttggcgcggct
ctgacggagtgcttcggccccgacaaggcggacatcatctacgactgcgcgggcaatgac
accaccatggatcaggccatccagaacgcccggaagggaagcgtcatcatcttggttgcg
gtgtacgctggcctggcccactgtgatctggccaagctcaacgactccgaactggatctg
aacaccaccatgatgtatcgccacgaggactatgtggatgccatccgctttgtacgcgag
ggcatggtacagctccaacccctgatgagcaggcattttgcctttaccgactatctggcc
gcttacgagtacatcgatacgcaccaggaaaccaccatgaaggtcctcatcgacgtggac
cccagcgacgactga

DBGET integrated database retrieval system