KEGG   Flavonifractor plautii: A4U99_18115Help
Entry
A4U99_18115       CDS       T04429                                 

Definition
(GenBank) DNA gyrase subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
fpla  Flavonifractor plautii
Brite
KEGG Orthology (KO) [BR:fpla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fpla03032]
    A4U99_18115
   03400 DNA repair and recombination proteins [BR:fpla03400]
    A4U99_18115
Enzymes [BR:fpla01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     A4U99_18115
DNA replication proteins [BR:fpla03032]
 Prokaryotic type
  DNA Topoisomerases
   A4U99_18115
DNA repair and recombination proteins [BR:fpla03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      A4U99_18115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C DUF2226 LigA Rho_RNA_bind TPD52
Motif
Other DBs
NCBI-ProteinID: ANU42867
UniProt: A0A1C7FU94
LinkDB All DBs
Position
3803487..3806015
Genome map
AA seq 842 aa AA seqDB search
MSKKPQYDPEEIRFPDQKIETSYLVHEMEQSYIEYAMSVIVGRALPDVRDGLKPVHRRIL
YAMYEDNLTADKPFKKSATCVGDVLGRYHPHGDASVYDALVRLAQDFSMRYPLVDGHGNF
GSIDGDPPAAYRYTEARMAKISDEMLREIEKDTVDWDPNFDESRKEPRVLPSRFPNLLVN
GSSGIAVGMATNIPPHNLREVINATICVLDNPEAELSDLMEHVKGPDFPTRGIIMGRSGI
RAAYATGRGRVCVRARTEFEEFGNNRTRIIVTEIPYQVNKRMLIKNMADQVEDKRLEGIS
DIRDESDRNGMRVVIELKRDANPQVVLNRLFAQTQLQTTFAINMLALVQSGGQPQPKILS
LRHILDEYIAFQEEVIVRRTRYDLRKAQERAHLLEGLLIAEDNIDAVIQTIRESYDDAKE
NLMNRFGLSDVQAQAILDMQLKRLQGLEKEKLQNEYKELEARIAYFNELLSSEEKIRGVL
KDELTAIRDRYGDDRVTEIQDVEDEIDIEDLIEEEECVFTLTAGGYIKRTAASTYKAQRR
GGKGITAMSTKEEDYVDTVFTSSTHDFILFFTNKGRVHRKKGYQIPEAGRTARGTNLVNV
LPIEQDEKVTAMIHLREFPEDRYLVMVTRSGTVKRIQLSSIYTARKAGIRCITLDEGDEL
ICVRETDGDQAILIVTHDGMAICFKETDVRCMGRDAAGVRGINLRPGDYVVGAARAKRDH
QVLMITENGYGKRTDMDEYIRADGPQKRGGFGLKGYNVTEKTGPVVGVKVVSDGDDVLVI
NDAGVIIRMAAAGISTYGRTAQGVKIMNLEEGVKVISFARTDHEEEEEAAEGDSPAVGSE
EE
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaagccacagtatgatccggaggaaatccggtttccagaccagaagatagag
acctcctatctggtgcacgagatggagcagagctacatcgagtacgctatgagcgtcatc
gtgggccgggcgctgcccgacgtgcgggacggcctgaagccggtccaccggcgcatcctc
tacgccatgtatgaggacaacctgaccgcggacaagcccttcaagaagtcggccacctgc
gtgggcgacgtgctgggccgctaccacccccatggcgacgcttcggtgtacgacgccctg
gtgcgcctggctcaggatttctccatgcgctaccccctggtggacggccacggcaacttc
ggctccatcgacggcgatcccccggccgcctaccgttacaccgaggcccgcatggccaag
atctccgacgagatgctgcgggagatcgagaaggacacggtggactgggacccgaacttc
gacgagagccggaaggaaccccgggtactgccctcccggttccccaatctgctggtcaac
ggctcctccggcatcgccgtgggcatggccaccaatattccgccccacaacctgcgggaa
gtgatcaatgccacaatctgcgttctggacaacccggaggcagagctgtccgacctgatg
gagcacgtgaagggccccgacttccccaccagggggatcatcatgggccgctccggcatc
cgggcggcctacgccaccggccggggccgggtgtgcgtccgggcccgcaccgagtttgag
gagttcggcaacaaccgcacccgcatcatcgtcaccgagatcccctaccaggtcaacaag
cgcatgctcatcaaaaatatggccgaccaggtggaggacaagcggctggagggcatctcc
gacatccgggatgagtccgaccgcaacggcatgcgggtggtcatcgagctcaagcgggac
gccaatccccaggtggtgctcaaccgcctgttcgcacagacccagctccagaccaccttc
gccatcaatatgctggccctggtgcagtccggcggccagccccagcccaagattctctcc
ctgcgccacatcctggacgagtacatcgccttccaggaggaggtcatcgtccgccgcacc
cgctacgatctgcgcaaggcccaggagcgggcccatctgctggagggcctgctcattgcc
gaggacaacatcgacgcggtgatccagaccatccgggagagctacgacgacgccaaggag
aacctgatgaaccgcttcggcctcagcgacgtgcaggcccaggccatcctggacatgcag
ctcaagcggctccaggggctggagaaggagaagctgcaaaacgaatacaaggagctggag
gcgcgcatcgcctacttcaatgagctgctctccagtgaggagaagatccgcggcgtgctc
aaggacgagcttaccgccatccgggacaggtacggcgacgaccgggtgaccgagatccag
gacgtggaggacgagatcgacatcgaggatctcatcgaggaggaggagtgcgtcttcacc
ctcaccgccggcggctacatcaagcgcactgccgcctccacctacaaggcccagcgccgg
ggcggtaagggcattaccgccatgtccaccaaggaggaggactatgtggacaccgtgttc
acctcctccacccacgatttcattctctttttcaccaacaagggcagggtccaccgcaag
aagggctatcagatccccgaggcgggccgcaccgcccggggcaccaacctggtcaatgtg
ctgcccatcgagcaggatgaaaaggtcaccgccatgatccacctgcgggaattccccgag
gaccgctatctggtaatggtcacccgcagcggcaccgtcaagcgcatccagctctcctcc
atctacaccgcccgcaaggcgggcatccgctgcatcaccctggacgagggggatgagctc
atctgcgtgcgggagaccgacggcgaccaggccatcctgatcgtcacccacgacggcatg
gccatctgcttcaaggagaccgacgtgcgctgcatgggccgggacgccgccggcgtccgg
ggcatcaacctgcgccccggcgactacgtggtgggggccgcccgggccaagcgggatcac
caggtgctgatgatcaccgaaaacggctacggcaagcgcaccgacatggacgagtatatc
cgcgccgacgggccccagaagcggggcggatttggcctgaagggctataatgtcaccgag
aaaaccggtccagtggtgggggtcaaggtggtcagcgacggggacgacgtgctggtgatc
aacgacgccggcgtgatcatccgcatggcggccgccggcatctccacctacggccgcacc
gcccagggagtcaagattatgaatttggaggagggggtcaaggtgatctccttcgcccgt
accgaccacgaggaggaagaggaggccgctgagggggattcccctgccgttggttcagag
gaggagtaa

DBGET integrated database retrieval system