KEGG   Francisella philomiragia O#319-036: LA56_1276Help
Entry
LA56_1276         CDS       T03618                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fpm  Francisella philomiragia O#319-036
Pathway
fpm00250  Alanine, aspartate and glutamate metabolism
fpm00410  beta-Alanine metabolism
fpm00430  Taurine and hypotaurine metabolism
fpm00650  Butanoate metabolism
fpm01100  Metabolic pathways
fpm01110  Biosynthesis of secondary metabolites
fpm01120  Microbial metabolism in diverse environments
fpm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LA56_1276
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LA56_1276
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LA56_1276
   00430 Taurine and hypotaurine metabolism
    LA56_1276
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LA56_1276
Enzymes [BR:fpm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LA56_1276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJI55318
LinkDB All DBs
Position
complement(1319964..1321304)
Genome map
AA seq 446 aa AA seqDB search
MALHAKNDMKHKLYKESLPKFEIPKKSNDAFEAYQQIKDELMLDGNSKQNLATFCQTEVD
DFIHRLMDDCIDKNMIDKDEYPLTAEIESRCVNILANLWNSSAENAIGCSTTGSSEAAML
GGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMTPE
TMLKYCDENTIGVVPTLGVTFTGQYEPVEAVCEALDKFERDTGIDIPVHVDAASGGFLAP
FVEPELRWDFRLPRVKSINSSGHKFGLSPLGVGWVVWADKKYLPQDLIFNVNYLGGDMPT
FALNFSRPGGQIVAQYYNFVKLGFEGYKNIHKLSYDVAKYIAKEIKGMGIFDIIHAGKGG
IPAVSWSLKAGKSYDLFDISEKIRARGWQIAAYSMPKDRQDLVVMRVLVRRGFSFDLAEL
MIRDLKNVINSLDNKSKDIERGGFSH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcgttacatgccaaaaatgacatgaaacataagttgtataaagaatcattaccaaaa
tttgaaattcccaaaaaatcaaatgatgctttcgaagcatatcaacaaatcaaagatgag
ctaatgctcgatggtaattcaaagcagaatttagcgacattttgtcaaacagaagttgat
gatttcattcataggcttatggatgattgcattgataagaatatgattgataaagatgag
tatcctctaactgctgaaatagagtcacgatgtgtcaacatactagcaaacctatggaac
tcttcagcagaaaatgcaatcggctgttcaactactggctcatctgaagcagctatgctt
ggcggtatggcaatgaagtggcgctggcgtgataagatgaaagctcaaggtaaagattat
acaaaacctaatcttgttacaggacctgtgcaagtctgctggcataaattcgctagatat
tgggatattgagcttagagagattccaatgtcaaatgaaagtttaataatgactccagaa
actatgcttaagtactgtgatgaaaatacaattggagttgtgcctactttgggggttacc
tttacaggtcagtacgagcctgttgaggcagtttgtgaagcacttgataaatttgagaga
gatactggtattgatattccagtgcatgtagatgctgcttctggaggatttttggcacca
tttgtagagcctgaacttaggtgggattttagattaccaagagttaagtcaattaattca
tcaggacataagtttgggttatcgccattaggagtgggttgggttgtttgggcagataag
aaatacttacctcaagatttgatttttaatgttaattatcttggtggcgatatgccgaca
tttgctttaaatttctctcgaccaggtggtcagatagttgcccagtactataactttgtt
aagcttggttttgaaggatataaaaatattcataagcttagttatgatgttgcaaaatat
attgctaaagaaattaagggtatgggtatctttgatattattcatgctggtaaaggtggt
atcccagcagtgagctggtcacttaaggcaggcaaaagttatgatttgtttgatatctct
gaaaaaattcgtgctagaggttggcagatagctgcttattcgatgccaaaagatagacaa
gacttggtagttatgcgagtgcttgttaggagaggctttagctttgatttagcagagctt
atgattagggatctaaaaaatgttattaactctttagataataaatctaaagatatcgaa
agaggtggtttttcgcattag

DBGET integrated database retrieval system