KEGG   Francisella philomiragia O#319-036: LA56_1652Help
Entry
LA56_1652         CDS       T03618                                 

Definition
(GenBank) glycosyl transferase group 2 family protein
Organism
fpm  Francisella philomiragia O#319-036
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_2_3 Glycos_transf_2 Glyco_tranf_2_3 Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: AJI54393
LinkDB All DBs
Position
1696978..1698657
Genome map
AA seq 559 aa AA seqDB search
MKKLLSLIAALLVLYGLSQVGETLASIALLSFLCCFVVYLFVTSKSRKLNLITIIYVLLS
FVFVVFTTCAILSVDYNSHPFVSMLILCILLPTFFLLGYRIILSIHCFIDSLLGKNKKFE
ETDEELGCSVVITTRNEPFDVCKLTFDSAYQLDYPADKIEIIIVDNSDLDHADFLKWQGY
VNKHNMQDGISCKFIHRNGTEGFKPRNLDIAMQHINFDYVLFLDADSTLPQSALKVGLPE
FKKDNRLGFVSFLIESTNYSTNLVTKVASIFQNTIRYFNEFVGKYGYCNYQGHNGIWSKQ
ALQAISKWEEYYKSQVMVTEDIAAGFRCYEAGFNSKPIFLKTGEWVPTSLKEFEKMWLRW
SFGGMQVMHKYMSNIISSSNLNFRVKLDMLYLLFKVVASGFPIFALLLVIFPRNNIAFVS
IVNVTLIPLLILSVWYYLYGDIKGSFISKISQIYIAMFMLSSFVFWCGIKAEINYYLNKP
QGWKPTSKVFDKVEGWAQVIYDNIGKLSFSLVGLIIAIYSIFTLYSQTDFYLYMLCMLPS
ILLFLNTILCVLVLGRARY
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgttatctcttatagcagctttactagttctttatggtctttcacaagtt
ggtgagactcttgcaagtatagcgctactatcttttttgtgttgttttgttgtctatcta
ttcgtgacatctaagtctcgcaagttaaatcttataacgataatatatgtattgttaagc
tttgtgtttgttgtatttactacatgcgcgatattgagtgttgattataactctcatcca
tttgtatcaatgttgatattgtgtatattgttacctactttctttttacttggttataga
attattttgagcattcattgtttcattgatagtcttttgggtaaaaataaaaagtttgag
gaaactgatgaagaactaggatgctctgtcgttataaccacacgtaatgaaccttttgat
gtttgtaaattaacttttgattcggcatatcaacttgattatcctgctgataaaatcgag
ataataatagttgataacagtgatttagatcatgcagacttcttgaagtggcaaggttat
gttaacaagcataatatgcaagatggtataagttgtaagtttatccatagaaatggtaca
gagggttttaaaccacgcaatcttgatattgcaatgcaacatattaattttgattatgta
ttgtttttggatgctgattcgactttacctcaaagtgcattaaaagtagggttaccagag
tttaaaaaagataatagacttggttttgttagtttcttgatagaaagtactaactacagt
actaatttagttactaaggttgctagtattttccaaaatacaattcgctattttaatgag
tttgtgggtaaatatggctattgtaattatcaagggcacaatggtatttggagtaaacaa
gcgttacaagcaatatctaaatgggaagaatattataaatctcaagttatggttacagaa
gatattgccgctggatttaggtgttatgaagcaggatttaatagtaagcctatttttctt
aaaacaggagagtgggttcctacatctctcaaagagtttgagaaaatgtggttaagatgg
tcttttggtggtatgcaagtaatgcataaatatatgtcaaatattataagctcatctaat
ctaaattttagagtgaagcttgatatgttatacttactatttaaggttgtagcttcaggt
tttccaatatttgcattattattggttattttcccaagaaataatatagcttttgtgtcg
atagtaaatgtgacacttattccattgcttatcctaagcgtttggtattatttatacggt
gatataaaaggtagttttataagtaaaatttctcaaatttatattgcgatgtttatgttg
tcatcatttgtattttggtgtggtataaaagcagaaataaattattatctaaataagcct
cagggctggaaaccaacaagtaaggtctttgataaagtcgaaggttgggcgcaagttata
tatgataatattggtaagttaagcttttctttggttggtttgattatagctatttattct
atttttacactttattctcaaactgacttttatttgtatatgttatgtatgttgccgagc
atattactttttttgaatactattttatgtgtgctagtattaggtagagcgagatactag

DBGET integrated database retrieval system