KEGG   Fictibacillus phosphorivorans: ABE65_001015Help
Entry
ABE65_001015      CDS       T04282                                 

Definition
(GenBank) hypothetical protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00550  Peptidoglycan biosynthesis
fpn01100  Metabolic pathways
fpn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABE65_001015
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ABE65_001015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fpn01003]
    ABE65_001015
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fpn01011]
    ABE65_001015
Enzymes [BR:fpn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ABE65_001015
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ABE65_001015
Glycosyltransferases [BR:fpn01003]
 Polysaccharide
  Bacterial polysaccharide
   ABE65_001015
Peptidoglycan biosynthesis and degradation proteins [BR:fpn01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ABE65_001015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase U79_P34 Centro_C10orf90
Motif
Other DBs
NCBI-ProteinID: ANC75518
UniProt: A0A160IHW3
LinkDB All DBs
Position
complement(187656..189938)
Genome map
AA seq 760 aa AA seqDB search
MIYAYVNGTPKLTADDLKDPQSSMIYDMNDEFITYVTSSERREYVKIDDIPELVQQAFIS
TEDVRFREHMGIDMKRIVGAAVANVQDGFGAEGASTITQQVVKNSVLSSDKTLERKVQEA
YLAIQLEQKYSKDQILEMYLNKIYFGSGAYGVATASKTYFNKPLKELTPAEAALLAGLPQ
RPSSYDPFLHPKVAEERRNTVLHLMYKNGAITKQQKEEAMKTAVTESLSKEKTKRLKYDA
FIQQVIKELKEKGVSERAIYEGGLKIYTTLDPKAQAHTEKVLSTEEYVNYPNDKFKAGVA
LLDTKTGVIRALGGNRTSGDQNIEKGFNYATDITRQPGSTIKPILDYGPAIEKFKWSTYK
QIKDEELEIDGWEAGNWDDDFHGDVSMREALVHSYNIPAIKTFMEVGSEDAVSFAKQLGI
PIKTAHPAYAIGGFGKGPSPLELAGAYTAFGNQGVYHKPTTLRSVKYPDGYETKYESKPV
AAMHDYTAYMITDMLKDVVKSGTGTLAAIPGLEVAGKTGTTNMPDGLDQIKKGSSDSWFA
GYTTNYTAAVWTGYDKTTAESYLTPEDQKIAKYIFKSIVSEVSKDKKTAGFSKPKSVEEV
YINKDTGYVTKDENGSNVTKELIVKGTSLKEMTAPVKAKKADKKERTKSNKNNKEKNKDD
KKKDSDKAKEEEKKKEDEKQTEPPTTKPEDEADPPPPQDDNPDDPGTTPEPEDPPTVPDP
PPTEPPPTTDPPPTEPPPADGGEGTGTGPGAGTSGTTTTP
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgatctatgcatatgtaaacggtactccaaagcttacagctgacgacttgaaagatcct
caatcctcaatgatctatgatatgaacgatgagttcatcacgtatgtaacaagctctgaa
cgacgagaatatgtcaagattgatgatataccagaactcgtccaacaagcatttatttct
actgaagacgttaggttcagagaacatatgggaattgacatgaaacgaattgttggggca
gccgttgcgaatgtacaagacggattcggcgctgaaggtgcaagcacgattactcagcaa
gtggttaaaaactcagttctatcgtcagacaaaacacttgaacgaaaagtgcaagaagcc
tacctggctattcaattagagcaaaagtattcaaaagatcagatcttagagatgtacctg
aacaaaatatactttggcagcggtgcatacggagtagcaacggcttcgaaaacatatttt
aataaaccattaaaagagctaactccagcagaagctgctcttttagctggtctgcctcaa
agaccgagcagttatgaccctttcctccaccctaaagtagcagaggaaaggcgtaatacc
gtactgcatctcatgtacaagaatggtgccattacaaaacagcaaaaagaagaagccatg
aaaacagctgtaacggaatctctatcaaaagaaaaaacaaagcgattaaaatacgatgct
tttattcagcaagtgattaaagaattaaaagaaaaaggagtatctgagagggcgatttat
gagggtggattaaagatctatacaacacttgatcctaaagctcaagctcatacggaaaaa
gtgctatccactgaagagtacgtcaactatccaaacgacaaatttaaagcgggtgtcgcg
ttgctcgataccaagactggtgttattcgcgcgttaggcggtaaccgaacaagtggtgat
cagaacatcgagaaaggtttcaactatgcgactgatattactcgccaacctggttccacc
atcaaacccatcttagattatggaccagctatagaaaagtttaaatggtctacgtataaa
cagattaaagatgaagagttagagattgacggttgggaagccggaaactgggacgatgat
tttcatggagatgtttctatgcgggaagcactcgtccattcttataatattcctgccatt
aaaacctttatggaagttggctctgaagatgctgtaagtttcgctaaacagctaggtatt
cctattaagaccgctcatcctgcctatgccatcggtggatttggtaaagggccatcacca
ttagaactagcaggtgcatacacagcattcggaaaccaaggtgtctaccataaaccaact
actcttcgtagtgtgaaatatcccgatggctatgaaacgaagtacgaatccaaacctgtt
gcagccatgcatgattacaccgcttatatgattacagatatgcttaaagatgtagttaaa
agtgggacaggaacgctagccgctatccctggattagaagttgcaggcaaaacgggtacg
acaaatatgccagacgggcttgatcaaataaagaagggctcaagtgactcctggtttgca
ggctatacaacaaactatacagccgcagtatggacaggctatgacaaaacaacggcagag
agttatctgacgcctgaagatcaaaaaattgctaaatacattttcaagtctatcgtctct
gaagtttcaaaggataaaaagacagccgggttttctaagccaaaatcagttgaagaagta
tacatcaataaagacactggctatgtaacgaaagacgaaaatggttctaatgtaacaaaa
gaactcattgtaaaagggacatcattaaaagaaatgacggcacctgttaaagcaaaaaaa
gcagataagaaagaacgaacgaaaagcaacaagaacaacaaagagaagaacaaggatgac
aagaagaaagattccgataaggctaaagaagaagagaaaaagaaagaagatgaaaaacaa
acagagccgcctacaacaaagccggaggatgaggctgatcctccaccaccacaagatgac
aaccctgatgatcctggtacaacaccagaacctgaagatccaccgacagtaccagatcca
cctccaacagaacctcctccgacaacagatcctcctccgactgaaccaccaccagcggac
ggtggtgaaggaacgggaacaggaccaggcgctggaacatctggaacaacgactacacca
taa

DBGET integrated database retrieval system