KEGG   Fictibacillus phosphorivorans: ABE65_001185Help
Entry
ABE65_001185      CDS       T04282                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00473  D-Alanine metabolism
fpn01100  Metabolic pathways
fpn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABE65_001185
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ABE65_001185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fpn01011]
    ABE65_001185
Enzymes [BR:fpn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ABE65_001185
Peptidoglycan biosynthesis and degradation proteins [BR:fpn01011]
 Precursor biosynthesis
  Racemase
   ABE65_001185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANC75549
UniProt: A0A168VQH3
LinkDB All DBs
Position
216903..218075
Genome map
AA seq 390 aa AA seqDB search
MDKHHYYRDTWAEIDLDKISQNIKSFKRHLPEQKIMAVVKANGYGHGALQVAEEALRSGA
EFLAVAMLDEGLALRKQGIKAPILVMNRVRPEYASLAAENEISLTVFQKEWLMEAQSYMK
ETKHQIKIHLKIDTGMGRVGFREESELQEVASFINQSPVFEAEGVFTHFATADEWESELF
EQQRKKFIEYIDLLKSWGLNPPLVHSANSAAALRKVEGPFNLVRLGISMYGLAPSNELKQ
DLPFPLEEAFSLHSRLIHVKKLMPGDTVSYGATYTATKEEWVGTLPIGYADGWQRRLSPG
ASVLINGERMPIIGRICMDQCMVRLPKRIDVGEVATLIGSQQAEKIEMDEIARIAETINY
EIPCLISARVPRVYTKKGRILENMNVILNF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggataaacatcattattatcgagacacttgggcagaaatcgacctagacaagatcagt
caaaatataaaatcttttaagagacatctccctgaacaaaaaattatggctgtcgtaaaa
gcgaacggatacggccatggagcacttcaagtggcagaagaggcattgagatcgggagct
gagtttctagctgttgcgatgctcgacgaaggattagctttgcgtaaacagggaatcaag
gcaccgattttagttatgaaccgtgtacgtccggaatatgctagtcttgcggctgaaaat
gaaataagccttacagtctttcaaaaagaatggctgatggaggctcaatcgtatatgaaa
gaaacgaaacatcaaataaagatacatctgaagatcgatacgggcatggggcgagtggga
tttagagaagaaagcgagctgcaagaagtagcgagcttcatcaaccaatctcctgtcttt
gaagcagaaggggtatttactcattttgcaacagctgatgaatgggaatcagagcttttt
gaacaacaaagaaagaagtttattgaatatatagacttgctgaaatcatggggattgaac
ccaccccttgttcacagtgcaaatagtgcagcagctcttagaaaagtcgaaggacctttc
aatcttgttcgactggggatcagcatgtatggtttagcgccttctaacgaactaaaacaa
gacttgccgtttccactagaagaggcattcagccttcattcccggctcattcatgttaaa
aaattgatgcctggggatactgtaagttatggagctacttatacagcaacaaaagaagag
tgggtaggtacattaccaatcgggtatgcagacggctggcaaagaagattatcaccagga
gcttccgttcttataaatggagaacggatgccgatcatcggcaggatctgtatggatcag
tgtatggtgagacttcctaagagaatagatgttggtgaagttgccactttaataggaagt
cagcaagcagaaaaaatagagatggatgagatcgcacgtatcgcagaaaccataaattat
gaaattccatgcctcatttctgctcgagtgccgagagtttatacgaaaaagggtcgaatt
ttagaaaatatgaatgtaattctaaatttttag

DBGET integrated database retrieval system