KEGG   Fictibacillus phosphorivorans: ABE65_007300Help
Entry
ABE65_007300      CDS       T04282                                 

Definition
(GenBank) alpha-amlyase
Organism
fpn  Fictibacillus phosphorivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C GHL6 hDGE_amylase Gram_pos_anchor Phage_rep_org_N Baculo_VP91_N Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: ANC76614
UniProt: A0A160IKP3
LinkDB All DBs
Position
1427575..1429101
Genome map
AA seq 508 aa AA seqDB search
MGKRMIFLAMSFLLFLSVQNKALAEKKEERSWKDETIYFIMVDRFNNGNKDNDFDVDLND
LSAYHGGDFKGIMDKLGYLDDLGVTAIWLTPVVKNEPGGYHGYWTEDFYETEEHFGSKDE
LKQLVKKAHDRDIKVILDLVVNHTGYKHPWLEDKSKKDWFHPEMEIGNWDNQEEVENGWL
AGLPDLNTENNETRKYLLDMAEYWIKETDIDGYRLDTVKHVPKDFWQEFSERVNQAKPGF
YLIGEVWHNDPRYIAEYNNAGIQSFVDYPLFNEMVRIFRQSGQSLSELNAVWERNKFYYK
DPYTLGNFIDNHDNIRFVREALLKQEDPEKRLKLALTYLYSAPGIPILYQGTEHMMDGAK
DPDNRRMMDFTQNKDFEKFTSKLGKLRQKHPALRRGDYSMILDKDGKAVFKRKYQDETLY
IVFNNDKKKSAISFTDKSLQNKKLVSLLSDEEIKVNNTSFEMNMAGETADIYSVQDADTN
WKFYLIAAIIVLLLSSFYIYKKRKKRTL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaagaatgatattcttggctatgtcgtttcttctttttttatctgttcaaaat
aaagcgcttgcagaaaaaaaggaagaacgatcatggaaagacgaaacgatttattttatc
atggtagaccggtttaataatggaaacaaagataacgactttgatgtagatcttaatgac
ctttcagcttatcatgggggagacttcaaagggatcatggataagcttggttatcttgat
gatctcggggttacggcgatatggctaacacctgtggttaagaacgaacccggaggctat
cacggttattggacggaggacttctatgaaaccgaagaacatttcggttcaaaggatgag
ttaaaacagcttgtcaaaaaagcacatgatcgagatataaaagtcatattagatcttgtc
gtaaatcatacagggtataaacatccttggttagaagacaagtcaaaaaaagattggttc
cacccagagatggaaatcggcaactgggataaccaagaagaagttgagaacgggtggctc
gctggattgcccgatctgaacacagagaacaatgaaacacgtaagtacttactcgacatg
gctgaatattggatcaaagaaacagacatagatggctatcgtttagatacggtaaaacat
gtgccaaaagatttttggcaagaattttcagaacgagtgaatcaggctaagcccggattc
tatttaatcggtgaagtttggcataatgatccaagatatattgctgagtacaataatgca
ggcattcaatcgtttgtagattatccattgtttaatgagatggttcgaatctttagacaa
agcggacaatcgctttcagagctgaacgctgtatgggagcgaaacaagttctattataaa
gatccgtataccttagggaacttcatagataatcatgataacattcgattcgtgcgtgaa
gcactgctgaagcaagaagatccggaaaagaggctaaagctcgctcttacttacctttac
tcggcacctggtattccaatcctctatcaaggaacagagcatatgatggatggagccaaa
gatccggacaatcgtcgtatgatggactttactcaaaataaggattttgaaaagttcact
tctaaattaggaaagcttagacaaaaacatcctgcactaagacgtggcgattattcgatg
attcttgataaagatgggaaagccgtctttaagcgaaaatatcaggatgaaacactttat
atcgtttttaacaatgataagaagaagtctgctatttctttcacagataaaagccttcaa
aataaaaaacttgtgagtctgttatcagacgaagagataaaggtgaacaatacttctttc
gaaatgaatatggctggggaaacagctgatatttattctgtacaagatgcagataccaat
tggaagttctacttaatagcagcaataatcgtactattgttaagttctttctatatttat
aaaaaaagaaaaaaacgcactttataa

DBGET integrated database retrieval system