KEGG   Fictibacillus phosphorivorans: ABE65_008390Help
Entry
ABE65_008390      CDS       T04282                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fpn  Fictibacillus phosphorivorans
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpn01001]
    ABE65_008390
Enzymes [BR:fpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ABE65_008390
Protein kinases [BR:fpn01001]
 Serine/threonine kinases: Other
  Bacterial family
   ABE65_008390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH RIO1 Kdo Kinase-like DUF4366 Pkinase_fungal Haspin_kinase FTA2
Motif
Other DBs
NCBI-ProteinID: ANC76816
UniProt: A0A160ILP4
LinkDB All DBs
Position
1635251..1637281
Genome map
AA seq 676 aa AA seqDB search
MIGKRVSGRYKLLEVIGDGGMAIVYRAKDLILDRDVAVKVLRSEFNKDEDFIRRFKREAE
SATSLNHPNIVSIYDVGEDEEIYFIVMEYVQGKTLKQYIKEHGKISVEESLHIMKQIVSG
MAVAHDHGIIHRDIKPHNILITDNGTAKLTDFGIALAITSATITHTNSILGSVHYFSPEQ
ARGGIANAKSDIYSFGAVLYEMVTGRVPFVGDSPVSVALKHLQENVIEPRRLNPEIPQSV
ENIVLKSLAKNPLKRYDSADELLSDMNSALDPDRMYEQKWNEESEEDEKTKYIPPIVVPP
VETPVQKVEAGTEKAKEDKTEKPKKKRNWWLILLISLLLLGGAGIAAFTMMPSIFYVEEV
SVPDVVGEEYVDAFDSLRAEGLEVKRQEVFDPEIEEGLVVRQDPTPGTKVKQQAIVTLFV
SKGPEKENMPDVEGYNIEDAKERLKEDGFTQININYEESDSEPEGTVLEQSPDRDEKVTP
AETEVTLTVSSGTPTVQVENLIGASEQDVKTFADNAGLTVEFSKEFSDTVEKGRVISQNP
SPFTQVEKGATISVVLSDGPESVEEEPPPAEEEPPAEDRTVTKDIEVKLDKKDKREPVTV
KIVYSDKNASNEVFVEEQITDKKKYKLPLTIAEGGSASYVVYVNGQEEESETINYDDVKS
ASGRMSRDDQEGDDGD
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaaaagagtcagtggccgctacaagcttttagaagttattggtgacggcgga
atggccatcgtttatcgagcaaaagatttaatcttagatagagatgtagcagtaaaagtt
ctgcgctcagagtttaataaagacgaagatttcatcagacgatttaaaagagaagcggaa
tcagcaacaagtcttaaccacccgaacattgtgagcatctatgatgttggagaagatgaa
gagatctattttatcgtgatggagtatgtgcagggaaaaacattaaagcaatacataaaa
gaacatggaaaaatatcggtagaagaatctttgcacattatgaagcagatcgtttctggg
atggcggtcgctcatgatcatggaatcattcatcgcgatattaaaccgcataatatatta
attacagataacggaacggctaagttaacagactttgggatcgcgctcgccatcacttca
gctacgatcacgcatacaaactctatactgggttctgttcattacttttcacctgaacaa
gctagaggaggtatcgcgaacgcaaaatcggatatctactcgtttggagctgtactctat
gaaatggttactgggagagtgccgttcgtaggagattcaccggtttctgttgcgttaaag
catctacaagaaaacgtgatcgaaccgcgaaggttgaatcctgaaatcccacaaagtgta
gagaacattgtattaaaatcgttggcgaaaaatcctttaaaaagatacgacagtgctgat
gaattgttgagcgatatgaattcagcactagatccagatcgtatgtatgaacaaaagtgg
aacgaggaaagcgaggaagatgaaaaaacgaagtatattcctcctatcgtcgtacctcca
gttgaaacacctgtgcaaaaagtggaagctggtacagaaaaagcgaaagaagataagacc
gaaaaacccaagaaaaaacgaaactggtggcttattttacttatctcccttttattatta
ggtggagcgggtattgctgcttttacgatgatgccttctatcttttatgttgaagaggtc
agtgttccagatgtcgtaggagaagaatatgtcgatgcttttgatagcttgagagccgaa
gggctggaagtgaaacggcaggaagtatttgatccagagatcgaagaaggtcttgtagta
agacaagacccaacgcctggaacgaaagtgaaacagcaggcaattgttacgttattcgta
tcaaaaggacctgaaaaagaaaatatgcctgatgttgaagggtataatattgaagatgca
aaagaacgattaaaagaagatggcttcacccagatcaatatcaactatgaagaatcagat
tctgaaccagaaggaaccgtactggagcaaagtcctgatcgtgatgaaaaagtaacacct
gcagaaacggaagtaacactaacagtcagttctgggacaccaacggttcaagttgagaac
ttgatcggtgcatctgaacaagatgtaaaaacgtttgctgacaatgctggactgacagtt
gaattttcaaaagagttctctgataccgttgaaaaaggcagagtcatctcgcaaaaccct
tctccttttactcaagttgaaaaaggggctacgatttctgttgtactttcagatggtcca
gaatcagtagaagaagaaccaccgccagctgaagaggaaccacctgcagaagatcgaacg
gtcacaaaagatattgaagttaagttagataagaaggacaaaagagaaccagttacagtt
aagatcgtatattcagacaagaatgcatcgaatgaagtgtttgttgaagaacagataacc
gacaaaaagaaatacaaattgcctctaacgattgctgaaggaggttctgcttcttacgtt
gtatatgttaacggacaagaagaggaatctgagacgatcaattatgatgatgtaaagagt
gctagtggacgaatgagtagagatgatcaggaaggggacgatggtgattaa

DBGET integrated database retrieval system