KEGG   Fictibacillus phosphorivorans: ABE65_015485Help
Entry
ABE65_015485      CDS       T04282                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00020  Citrate cycle (TCA cycle)
fpn00480  Glutathione metabolism
fpn01100  Metabolic pathways
fpn01110  Biosynthesis of secondary metabolites
fpn01120  Microbial metabolism in diverse environments
fpn01130  Biosynthesis of antibiotics
fpn01200  Carbon metabolism
fpn01210  2-Oxocarboxylic acid metabolism
fpn01230  Biosynthesis of amino acids
Module
fpn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABE65_015485
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ABE65_015485
Enzymes [BR:fpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ABE65_015485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANC78124
UniProt: A0A160IPA5
LinkDB All DBs
Position
complement(3002500..3003768)
Genome map
AA seq 422 aa AA seqDB search
MSNGERITVDNGVLNVPNQPVIPFIEGDGTGPDIWAAASRVLEAAVEKAYNGEKKIVWKE
VLAGEKAFNQTGEWLPAETLDVIRDYIIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVQYFKGVPSPVKRPEDTNMVIFRENTEDIYAGIEYASGSDEVKKLIQFLQDEMGANKIR
FPETSGIGIKPVSSEGTQRLVRAAIQYAINEGRKSVTLVHKGNIMKYTEGAFKNWGYELA
EAEFGDKVFTWAQYDRIVEESGKDAANKAQADAEAAGKIIVKDSIADIFLQQILTRPAEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLMLEHLGWGEAAKLVLSSMENTIASKVVTYDFARLMDGATEVKCSEFADELIK
NM
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacggagaacgtattacagtcgacaatggtgtattaaacgtaccaaatcaaccg
gtgatcccttttatcgaaggtgacggtacaggtcctgatatttgggctgctgcttcacgt
gtattagaagctgctgttgaaaaagcatataatggtgagaaaaagatcgtttggaaagaa
gtattagcaggagagaaagcatttaaccaaacaggtgagtggcttcctgcagaaactctt
gatgtgattcgcgattacataattgcgattaaaggacctttaacaacgccagtaggcgga
gggatccgttctttaaacgttgctttaagacaagagttagatctatttacttgtctacgt
cctgttcaatactttaaaggtgttccttcaccagttaaacgtcctgaagacacaaacatg
gttattttccgtgagaatacagaagatatctatgctggtatcgaatatgcaagtggatct
gatgaagttaaaaagttgattcaattcctacaagatgaaatgggtgctaacaaaatccgt
ttccctgaaacttctggtattggtatcaagcctgtatcttcagaaggtactcaacgtctt
gttcgtgcagctattcaatatgcgatcaacgaaggacgtaagagtgtaactttagttcat
aaaggaaacatcatgaagtatacagagggtgctttcaagaactggggatatgagttagca
gaagctgagtttggtgacaaagtattcacatgggctcagtatgaccgtatcgttgaagaa
agcggaaaagatgctgcaaacaaagcacaagcagatgctgaagctgcaggaaagatcatt
gttaaagactctatcgctgatatcttcttacaacagatcttaactcgtccagctgagttt
gatgtagttgctacaatgaacttaaatggagattacatctctgatgctcttgcagcacaa
gttggtggtatcggtatcgcaccaggtgctaacatcaactacgaaacaggacatgctatc
tttgaagcaactcatggtactgcaccaaagtatgctggtcttgataaagtaaacccatca
tctgtaattctttcaggtgtgttgatgcttgaacatctaggatggggagaagctgctaaa
ttagtactttcttctatggaaaacacaatcgcaagtaaagttgttacttacgatttcgca
cgtttgatggacggcgctacagaagttaaatgttctgagtttgctgacgaactaattaaa
aacatgtaa

DBGET integrated database retrieval system