KEGG   Fictibacillus phosphorivorans: ABE65_015515Help
Entry
ABE65_015515      CDS       T04282                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00010  Glycolysis / Gluconeogenesis
fpn00030  Pentose phosphate pathway
fpn00051  Fructose and mannose metabolism
fpn00052  Galactose metabolism
fpn00680  Methane metabolism
fpn01100  Metabolic pathways
fpn01110  Biosynthesis of secondary metabolites
fpn01120  Microbial metabolism in diverse environments
fpn01130  Biosynthesis of antibiotics
fpn01200  Carbon metabolism
fpn01230  Biosynthesis of amino acids
fpn03018  RNA degradation
Module
fpn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABE65_015515
   00030 Pentose phosphate pathway
    ABE65_015515
   00051 Fructose and mannose metabolism
    ABE65_015515
   00052 Galactose metabolism
    ABE65_015515
  09102 Energy metabolism
   00680 Methane metabolism
    ABE65_015515
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ABE65_015515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:fpn01009]
    ABE65_015515
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:fpn03019]
    ABE65_015515
Enzymes [BR:fpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ABE65_015515
Protein phosphatases and associated proteins [BR:fpn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ABE65_015515
Messenger RNA biogenesis [BR:fpn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ABE65_015515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat PGP_phosphatase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ANC78129
UniProt: A0A168W613
LinkDB All DBs
Position
complement(3009648..3010607)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKGIYHDLEVYGIYNGYAGLISGNIKKLELGSVGDI
IHRGGTMLHSARCLEFKTPEGQQKGIEQLKKFGIEGLVVIGGDGSFQGAKKLSEQGYPTI
GVPGTIDNDIPGTDFTIGFDTALNTIIDAIDKIRDTATSHERTYIIEVMGRDAGDLALWA
GLADGAETILIPEEDHKMDQVVQKLQRGHERGKKHSIIIVAEGCGSGVDVAKEIERLSDF
ETRVTVLGHIQRGGSPTAFDRVLASRLGAQAVELLLEGKAGRTVGIENNKLVDYDITEVL
SRKHSIDKQMYKLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggataggagttctaacaagtggtggcgattcaccaggcatgaacgctgcgatt
cgggcagttgttcgaaaaggaatctaccatgacttagaagtttatgggatatacaatggt
tatgcaggactaatttcggggaatattaaaaaactagaattaggatctgttggggatatt
atacatcgtggaggcacaatgcttcattcggcacgttgtttagagttcaaaacaccagaa
ggacaacaaaaaggtatcgaacagttaaagaaattcggtatcgaaggattagttgttatt
ggtggggacggatcttttcaaggtgctaagaaattgtctgaacaaggttatccaacgatt
ggtgttcctggaacgattgataatgacatcccgggtacagatttcacgattggttttgat
acagcattaaatacgattatcgatgcaatcgataagatccgtgacacggctacctcacat
gagcgtacttatatcattgaagtaatgggacgtgacgctggtgacttagctctatgggct
ggacttgcagatggtgctgagacgatcctcattcctgaagaagatcacaagatggatcaa
gtcgttcaaaagctacagcgaggacacgagcgtggaaagaaacacagtatcattattgtc
gctgaaggttgtggaagcggcgttgatgttgctaaagagatcgaaaggctttcagacttc
gaaacaagggttactgttctgggtcacattcaacgtggtggttcccctacagcttttgac
cgtgtactagcaagccgtcttggtgcgcaagcggttgaactcttattagaaggtaaagct
ggacggacagtaggtattgaaaataacaaacttgttgattatgacattacagaagtatta
tctagaaaacattcaatagataagcaaatgtataaattatcacaagaattatctatataa

DBGET integrated database retrieval system