KEGG   Fictibacillus phosphorivorans: ABE65_017270Help
Entry
ABE65_017270      CDS       T04282                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00340  Histidine metabolism
fpn01100  Metabolic pathways
fpn01110  Biosynthesis of secondary metabolites
fpn01230  Biosynthesis of amino acids
Module
fpn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ABE65_017270
Enzymes [BR:fpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     ABE65_017270
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     ABE65_017270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG Rad21_Rec8
Motif
Other DBs
NCBI-ProteinID: ANC78453
UniProt: A0A160IPU8
LinkDB All DBs
Position
complement(3366493..3367137)
Genome map
AA seq 214 aa AA seqDB search
MNVEKLKFDEKGLIPAVVQDVQSKEVLTVAYMNRESLQKTIEIGETVFFSRSRQELWHKG
ETSGNTQKVRSIRYDCDQDALVVVVEPQGPACHTGTYSCFSETLYEVDERVDAPNPDRYR
ILTELQEIIAKREHEMPEGAYTTYLFEHGVDKILKKVGEEAGEVIIAAKNRDVEELKWEV
SDLFYHVLVLLQEQKVPLDEILATLKERHTKKDN
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtagaaaaactgaaatttgatgaaaaaggactaattcctgccgtagtacaggat
gttcaatcaaaagaggtactaacggtcgcatacatgaaccgagaatcgctccaaaaaacg
atcgaaattggggaaacggtatttttttcaagatcgcgacaagaattatggcacaaaggt
gaaacttccggaaatacacaaaaagtgagaagtatccgctatgattgtgatcaagacgct
ttggtcgtcgttgtagagccccaagggcctgcttgtcacacgggcacatatagttgcttt
tcagaaacactttatgaagtggatgagagagtagatgcgccaaaccctgatcgatataga
attctaacagagctgcaagagattatcgcaaaacgagagcatgagatgccagaaggtgct
tacacaacctatctttttgaacacggagtcgataagattctgaagaaagttggagaagaa
gcaggagaagtgatcatcgctgcaaaaaatcgtgatgttgaagagttgaagtgggaagtt
tcggaccttttctatcatgtattagttctgttgcaagagcaaaaggtgcctttagacgag
attttggctacattaaaagaaagacatacgaaaaaggacaactga

DBGET integrated database retrieval system