KEGG   Fictibacillus phosphorivorans: ABE65_019890Help
Entry
ABE65_019890      CDS       T04282                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
fpn  Fictibacillus phosphorivorans
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fpn01002]
    ABE65_019890
Enzymes [BR:fpn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     ABE65_019890
Peptidases [BR:fpn01002]
 Metallo Peptidases
  Family M4: thermolysin family
   ABE65_019890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ANC78938
UniProt: A0A160IR09
LinkDB All DBs
Position
complement(3918599..3920266)
Genome map
AA seq 555 aa AA seqDB search
MKKQLSVWGLALGLAVSPFAAGQASAEAPVNVLSTKKMNSLTGTPSFVSGKLSEASSKSA
KEVVFNYLQKESKTFKLGSQKAEESFEVKSVTKDELGRQLVRIQQTYKGVPVWGSTQVAH
VNEKGELVVFSGTVTPNLQSKPGLGFAKKITAAKAVTVAVKNLGFTPEYEADPTSELVVY
TNGDKANYAYLVNLNFLSPEPGNYNYFVDAVTGKILNSYNDLDEAHGDPKAPPTGKGTLV
GTNAIGTGTGVLGDTKSLNTLLSNGSYYLQDNTRGNGVFTYDAKNRQQLPGTLWADADNK
LNATYDRAAVDAHYYAGATYDYYKEVFNRNSYDNKGAALKSTVHYGRNYNNAFWNGQQMV
YGDGDGTTFVSLSGGLDVVAHELTHAVTDFSSDLIYQNESGALNEAMSDIFGTLVEHHEN
NNPDYEIGEDIYTPGTPNDALRSMSDPTKYQDPDHYSVRYTGTGDNGGVHINSGIINKAA
YLLAVGGTHYGVTVPAIGNQKVGAIYYRANTVYLTASSNFSQARAALVQSASDLYGATSP
EVAAVKKSYDAIGVN
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcaattatcagtatggggattggcacttggacttgcagtaagtccgtttgca
gcaggacaagcatcagcggaggcaccagttaatgttttatcaactaaaaagatgaacagt
ttaacgggtacaccatcgttcgtctctggaaaactgtctgaggcgtcttcaaaatcagca
aaagaagtggttttcaactatcttcagaaagaatcgaaaacattcaaattaggttctcaa
aaagcggaagagtcgtttgaagttaagtctgttacaaaagatgagttaggcagacaactc
gtacgcatccaacaaacttataaaggcgttcctgtttggggctccacgcaagtagcacat
gttaacgaaaagggagagctcgttgtgttttctggaacagttactcctaatcttcaaagt
aaacctgggttaggctttgccaaaaagatcacagctgcaaaagcagtgaccgttgcggtt
aaaaatctcggtttcacacctgaatatgaagcagatcctacatctgaacttgttgtatat
acaaatggagataaagcgaactatgcatatttggtgaatttaaacttcttatcgcctgaa
ccaggtaactataattactttgtagatgctgtaacaggcaagatcctgaattcttacaac
gacttggatgaagcgcatggagacccaaaagcgccgccaacgggtaaaggaacattagta
gggacgaatgcgattggtacaggaacgggtgtacttggcgatacgaaatcactgaacaca
ttattatcgaacggttcgtattatttgcaggataacacgcgaggaaacggcgtatttaca
tacgatgcgaagaaccgtcagcagcttcctggcacattatgggcagacgcggataacaag
ctgaacgcgacttatgacagagcagcagtagatgctcactattatgcaggtgcaacgtac
gattattataaagaagttttcaaccgcaactcgtatgacaataaaggagcagcattaaaa
tcaacggttcactacggtcgtaattacaacaacgcgttttggaacggacagcagatggtc
tatggtgatggcgatggcacgacgttcgtgtccctgtctggcggattagatgtagtcgca
catgaattaacacatgctgtaacagatttttcatctgatctgatctatcaaaacgaatca
ggtgcgttgaacgaagcgatgtccgatattttcggcacgctagtcgagcatcatgaaaat
aacaatccggactatgaaattggagaagatatctacacaccaggaacaccgaatgacgcg
cttcgttcgatgagtgacccgacgaaatatcaagatcctgatcattactccgttcgctac
acaggaacaggggacaatggcggggtgcacatcaacagcggtatcatcaacaaagcggca
tacttgctagcagtcggtggaacgcattatggtgtaacggttcctgcgatcggcaaccaa
aaagtaggagcgatctactaccgagcaaacacagtgtacttaacagcttcttcaaacttc
agccaagcaagagcggctcttgttcaatcagcatctgacctttatggagcaacatctcca
gaagtagcggcagttaaaaaatcgtatgatgcgattggtgtaaactaa

DBGET integrated database retrieval system