KEGG   Fictibacillus phosphorivorans: ABE65_019985Help
Entry
ABE65_019985      CDS       T04282                                 

Definition
(GenBank) aquaporin
  KO
K02440  glycerol uptake facilitator protein
Organism
fpn  Fictibacillus phosphorivorans
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fpn02000]
    ABE65_019985
Transporters [BR:fpn02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    ABE65_019985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP DS
Motif
Other DBs
NCBI-ProteinID: ANC78956
UniProt: A0A160IRE9
LinkDB All DBs
Position
complement(3939663..3940490)
Genome map
AA seq 275 aa AA seqDB search
MSTFMAELIGTMILIIFGGGVVANVSLNKSKAQGGGWIVVALAWGLAVAMAVYAVGSFSG
AHLNPAVTLGLASIGEFAWADVPAYILAQMIGGILGGMVVFFHFLPHWKATDDPAVKLGV
FSTDPAIPHTFSNLLSEFIGTAVLLVGLLSIGANKFSDGLNPLIVGFLIVAIGLSLGGPT
GYAINPARDLGPRIAHFILPIPGKGGSNWTYSWIPVVGPVLGGVFGALFYQAVFTGKVTT
LFWIWTVVSLAIFAITFFLGSKGTQALPHGDQIEN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatttatggcagaacttataggaacaatgattctaattatatttggcgggggc
gttgttgcaaacgtttccttgaataaatcaaaagctcaaggtggcggatggattgtagtt
gcgcttgcttggggactagccgttgcgatggcggtttatgcagtcggaagctttagtggt
gcacatcttaacccagccgtaacacttggccttgcttcaatcggtgaatttgcttgggca
gatgtaccagcttatattctggcacaaatgatcggcggtatcttaggtggaatggtcgtc
ttcttccacttcctgccgcactggaaagcaacggatgatccagctgtaaaattaggagtt
ttctcaacggaccctgcaattccgcatacgttttcgaatcttttatcagaatttattgga
actgcggttttactagtaggattattgtcaatcggagcgaataaattttcagatggattg
aatccactaatcgtcggattcctaatcgtagccatcggattatcacttggtggaccaaca
ggatatgcgatcaacccagcacgtgacctcggtccaagaattgcacattttatcttgccg
attccaggcaaaggcggatcgaactggacgtactcatggattccggttgtagggccagtg
ctcggcggagttttcggagcattgttctatcaagctgtttttacaggaaaagttacaacc
ttattctggatctggacagtggtttcactagcgattttcgcaataacattcttcttagga
agtaaaggcacacaagcattgcctcacggtgatcaaatagaaaactaa

DBGET integrated database retrieval system