KEGG   Fictibacillus phosphorivorans: ABE65_020210Help
Entry
ABE65_020210      CDS       T04282                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00240  Pyrimidine metabolism
fpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ABE65_020210
Enzymes [BR:fpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ABE65_020210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ANC78998
UniProt: A0A160IR58
LinkDB All DBs
Position
complement(3979212..3979838)
Genome map
AA seq 208 aa AA seqDB search
MYVMNQNGWIELICGSMFSGKSEELIRRVRRATYAKQKVQVFKPLIDNRYSEESVVSHNG
TAVMAEPVGRSVEILKNVLPETEVVAIDEVQFFDEDIIPVAQELADQGLRVIVAGLDQDF
KGEPFGPVPKMMALAEHVTKLQAICMVCGSPASRTQRLIDGRPASYDDPVILVGASESYE
PRCRHCHEVPGKKRNLLSSAEGLEGRLK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtgatgaatcaaaatggctggatcgaattgatctgcggcagcatgttctctgga
aaatcagaagaacttattcgccgcgtaagaagagcgacgtatgcaaagcaaaaagtacag
gtgtttaagccgctgatcgataaccgctatagcgaagaatcggttgtgtctcataacgga
acagctgttatggctgaaccagtcggacgttctgtggagatcttaaaaaatgtattgcct
gaaaccgaagtcgtagcgatcgacgaagtgcaattctttgatgaagatatcatcccagtt
gctcaagagttagcagatcaaggactgcgcgtaatagtagcagggctcgatcaagacttt
aaaggcgagccgttcggacccgttccaaaaatgatggctcttgctgaacatgtgacaaag
ctgcaagcgatctgcatggtttgtggctcaccagctagccgtacacagcgtttgatcgat
ggcagacctgcttcttacgatgatccagtgattctagtgggagcatccgagtcatatgaa
ccgcgctgtcgccattgtcatgaagtaccaggaaagaaaagaaacctcctttcaagcgca
gagggcttagaaggtcggttgaaataa

DBGET integrated database retrieval system