KEGG   Flavobacterium psychrophilum FPG3: FPG3_00125Help
Entry
FPG3_00125        CDS       T03296                                 

Definition
(GenBank) hypothetical protein
Organism
fpo  Flavobacterium psychrophilum FPG3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PorP_SprF
Motif
Other DBs
NCBI-ProteinID: AIN72967
LinkDB All DBs
Position
28731..32459
Genome map
AA seq 1242 aa AA seqDB search
MKKEFINLLLILGFILPNHAQTGGVVSFDVPAKNSLKFNKFLINPTFSFVREDESFVSMY
NKRQFSGLENAPQAYFASYSGKFREDNAIGFGLFQRNYGVLTTFGIVGNFARNVELSNNS
NFTFGLNLAYINSGLNTGKIVTGEAEPLLQTVPKNSLVTINPGLNYSTGFIDFGIAANNI
FTYNFSGSDLVSDDPAKSFVGHVMYTGYLYNNSGLFENGKFSMIVKGEAAKEKTIFSTNL
LLNAPKAGWVQAGYNSLYGISAGIGFTVAKKLSIGYTLEKGIGNLSNLGLSHEITLAYKL
KGYGDFEDYKPIVKATKKTNPGTKNATVNKKTPADLQKERAEALALKTEKDKARAEAEKV
RKAKELADAKEKAEVLAALRKAQADKLLALQGKDKAVLEAERQRKLKEAADSRANNANAA
RLKAEQDKANALAESQRLRNEKAAADAKAKTDAQRLRTEKAIADAKALADAKAQARTNAA
KALADAANAKAEAERLRKEKADADAKALADAKAQARTNAAKALADAANAKAEAERLRKEK
ADADAKALADAKVQAKAEADKLKANQAEAERLRKEKAIAEAKALADAKVQAKSEADKLKS
NQAEAERLRKEKADAEAKALADAKVQAKSEADKLKANQAEAERLRKEKADADAKALADAK
AQAKAEADKLKANQAEAERLRKEKADADAKALADAKAQAKSEADKLKANQAEAERLRKEK
ADADAKALADAKAQAKSEADKLKANQAEAERLRKEKAIADAKALADAKAQAKSEADKLKA
NQAEAELLRKEKADADAKALADAKAQAKSEADKLKANQAEAERLRKEKADADAKALADAK
AQAKAEADKLKANQAEAERLRKEKADADAKAQAKSEADKLKANQAEAERLRKEKADADAK
AQAKAEADKLKANQAEAERLRKEKAEADAKALADETTERLRKEADAKAKIDEAKTTEDKE
LDNLSQVLEDSKKNQKQSLSRLDSITKAKDNELKELRRVNDLSDKGIVSEAKDFQNTSAA
NRALESLKSEIAESSKNQNNFIKEFETLTNERLKKVPNRNDIVNQSNLKSLEKLKLDKLN
SDKQNADLLTKLETIKAETVIEKSRRIKRAQFDSDDAKYQKDRETLKEIKTSTAPTGQTY
KPTDFDFGEEQAGTQIIKNNDNIPEGYYIVIAIHKDVAKRDAFVKKAIQAGQKDIDFFYN
ASNGNYYIYYDRQNQIQEATTAMESKGSKPYNGKMVIVKVEK
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaatttataaatttattactaattttaggtttcattttacccaaccacgca
caaacaggaggtgtggtttcgtttgatgtgcctgcaaaaaactcactaaaatttaataaa
ttcttaataaatccaacttttagttttgtacgtgaagatgaatcttttgttagtatgtac
aacaaaagacaattctcaggactcgaaaacgcaccacaagcttattttgcaagttattca
ggaaaatttagagaagataacgcaataggtttcggattatttcaacgcaactacggagta
ctaactacattcggaatcgttggaaactttgccagaaatgtcgaactttctaataacagc
aattttactttcggattaaatttagcatatataaacagcgggttaaacaccggaaaaata
gttaccggagaagctgaacccttattacaaaccgtaccaaaaaattcattagttaccata
aacccaggattaaattatagtactggttttatcgattttggtatagccgcaaacaacatt
tttacctataatttttcgggttcagatttagtttcagatgaccccgcaaagagtttcgta
ggacacgttatgtacacaggttacctgtataacaattcaggactattcgaaaacggaaaa
ttttctatgatagtaaaaggagaagccgcaaaagaaaaaactatttttagcacaaactta
cttcttaatgcacccaaagccggttgggtacaagcagggtacaatagcctttacggaatt
tcagcaggaataggctttacagtagcaaaaaaattatcaataggatatacactcgaaaaa
ggaataggaaatctatcaaacctgggcttatcacacgaaatcacattagcatacaaacta
aaaggttatggcgattttgaagactataagccaatagtaaaagctactaaaaaaacaaat
ccaggaacaaaaaacgcaacggttaataaaaaaacgcctgccgatcttcaaaaagaacga
gcagaagcattagccctaaaaaccgaaaaagacaaagcaagagcagaagcagaaaaagta
agaaaagctaaagaattagccgacgccaaagaaaaagcagaagtattagcagcacttaga
aaagcgcaagccgataaattattagccttacaaggaaaagacaaagcggttctagaagca
gaaagacaaagaaaactaaaagaagctgcagattccagagcaaataacgcaaatgccgca
agacttaaagcagaacaagacaaagcaaatgcattagcagaatcacaaagattaagaaac
gaaaaagcagccgctgatgctaaagcaaaaaccgatgcccagcgtttgcgtacagaaaaa
gcaattgccgatgccaaagcgcttgccgatgccaaagcacaagcaagaacaaatgccgca
aaagcacttgcagatgccgcaaatgctaaagcggaagctgaacgtttgcgcaaagaaaaa
gctgatgccgatgccaaagcgcttgccgatgccaaagcacaagcaagaacaaatgccgca
aaagcacttgcagatgccgcaaatgctaaagcggaagctgagcgtttgcgtaaagaaaaa
gctgatgccgatgccaaagcgcttgccgatgccaaagtacaagcaaaagccgaagccgac
aagctaaaagccaaccaagcggaagctgagcgtttgcgtaaagaaaaagcaattgccgaa
gccaaagcacttgctgatgccaaagtacaagcaaaatccgaagccgacaagctaaaatcc
aaccaagcggaagctgaacgtttgcgcaaagaaaaagctgatgccgaagccaaagcactt
gctgatgccaaagtacaagcaaaatccgaagccgacaaactaaaagccaaccaagcggaa
gctgaacgtttgcgcaaagaaaaagctgatgccgatgccaaagcgcttgctgatgccaaa
gcacaagcaaaagctgaagccgacaaactaaaagccaatcaagcggaagctgaacgtttg
cgcaaagaaaaagctgatgccgatgccaaagcacttgctgatgccaaagcacaagcaaaa
tccgaagccgacaaactaaaagccaaccaagcggaagctgagcgtttgcgcaaagaaaaa
gctgatgccgatgctaaagcacttgctgatgccaaagcacaagcaaaatccgaagccgac
aaactaaaagccaaccaagcggaagctgaacgtttgcgcaaagaaaaagcaattgccgat
gctaaagcacttgctgatgccaaagcacaagcaaaatccgaagccgacaaactaaaagcc
aaccaagcggaagctgaacttttgcgcaaagaaaaagctgatgccgatgccaaagcactt
gctgatgccaaagcacaagcaaaatccgaagccgacaaactaaaagccaaccaagcggaa
gctgaacgtttgcgcaaagaaaaagctgatgccgatgccaaagcgcttgctgatgccaaa
gcacaagcaaaagccgaagccgacaaactaaaagccaaccaagcggaagctgaacgtttg
cgcaaagaaaaagctgatgccgatgccaaagcacaagcaaaatccgaagccgacaaacta
aaagccaaccaagcggaagctgaacgtttgcgcaaagaaaaagctgatgccgatgccaaa
gcacaagcaaaagccgaagccgacaaactaaaagccaaccaagcggaagctgaacgtttg
cgcaaagaaaaagcagaagccgatgccaaagcgcttgctgacgagacaactgaacgcttg
cgtaaggaagccgatgctaaagccaaaattgacgaagccaaaacaactgaagacaaagaa
ttagataacctaagccaagttctagaagactctaagaaaaatcagaagcaatcgttatct
agattagactcgattacaaaagcaaaagataatgagcttaaggaacttagaagagtaaat
gatttgtctgataaaggtatcgtgagcgaagccaaagactttcaaaatactagtgccgca
aatagagcattagaatcgttgaaaagcgaaatagccgaaagttctaaaaatcaaaataat
tttatcaaagagtttgaaacacttacaaacgaaagattgaaaaaagtgcctaatagaaat
gatattgttaatcaaagtaatttaaaaagtcttgaaaaattaaagctagataaattaaat
agcgacaaacaaaatgcagatttattaaccaaattagaaacaattaaggccgaaacagtt
atcgagaaaagcagaagaatcaagcgagcacaatttgatagtgatgatgcaaaatatcaa
aaagatagagaaacacttaaagaaataaaaacaagtactgcaccaacaggtcagacttat
aaaccaacagatttcgattttggggaagaacaagcaggtacacaaatcatcaaaaacaac
gataatatacctgaaggatattatattgttatagcaatacacaaagatgtagcaaaaaga
gacgcattcgttaaaaaagcaatacaagcaggtcaaaaagatatagactttttctataac
gcaagtaatggaaattattatatttattatgatcgacaaaaccaaatacaagaggctaca
actgccatggaaagcaaaggaagcaaaccatataacggtaaaatggtgattgtgaaggtc
gaaaaataa

DBGET integrated database retrieval system