KEGG   Flavobacterium psychrophilum FPG3: FPG3_11075Help
Entry
FPG3_11075        CDS       T03296                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fpo  Flavobacterium psychrophilum FPG3
Pathway
fpo00240  Pyrimidine metabolism
fpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FPG3_11075
Enzymes [BR:fpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FPG3_11075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AIN74784
LinkDB All DBs
Position
2402454..2403062
Genome map
AA seq 202 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPTIDTRYDDEM
VVSHNKNEIRSTPVPAAANIAILAQGCDVVGIDEAQFFDDEIVKICNDLANSGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKTDNDKLVMLGETEEYEP
LSRAAYYNAMRENMIVKDAEHL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagagcagtttggttggattgaagttatttgc
ggatcgatgttttcgggtaaaaccgaggagttaattcgtagattaaaaagagcacaattt
gccaaacaaaaagtcgaaatttttaaacccactatcgataccagatatgatgacgaaatg
gtggtttcgcacaacaaaaacgagattagatctacgcctgttcccgcagctgcaaacatt
gcaattttagcccaaggttgcgatgttgttgggattgatgaggcgcaattttttgatgac
gagattgtaaaaatttgtaatgaccttgccaattcaggcattagagttattgtggctgga
ttggacatggattttaaaggaaatccttttggccccatgccagcacttatggcaacggca
gaatatgttacaaaagtacacgccgtttgtacccgtacaggaaatttggccaattatagt
tttcgcaaaaccgataatgacaaactcgttatgcttggcgaaaccgaagaatacgaaccc
ttaagtcgtgccgcatattataatgccatgagagaaaatatgattgtaaaagatgctgaa
catttataa

DBGET integrated database retrieval system