KEGG   Flavobacterium psychrophilum FPG3: FPG3_11080Help
Entry
FPG3_11080        CDS       T03296                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fpo  Flavobacterium psychrophilum FPG3
Pathway
fpo00473  D-Alanine metabolism
fpo01100  Metabolic pathways
fpo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FPG3_11080
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    FPG3_11080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fpo01011]
    FPG3_11080
Enzymes [BR:fpo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     FPG3_11080
Peptidoglycan biosynthesis and degradation proteins [BR:fpo01011]
 Precursor biosynthesis
  Racemase
   FPG3_11080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AIN74785
LinkDB All DBs
Position
2403081..2405525
Genome map
AA seq 814 aa AA seqDB search
MTISLHNIIPILDANFQGIDDNIYYDNISIDSRSLQNNENTLFFALVGPNNDAHIYIGDL
ISKGVKNFVVTYIPKRLTGKANFLIVKNTLVALQIFARYYRNLFHFPIIGITGSNGKTIV
KEWLNFLLSPDYNIIRSPKSYNSQVGVPLSVIAINENHNLGIFEAGISTKDEMENLQKII
QPTIGILTNIGTAHDEGFADISEKIKEKLKLFTAVEVLILNKNKTIETFINKEINTFTWS
TNDQSADVFFQKKTLNDHALLNITNQGKYFKIKIPFIDEASLENSMHCILVMLYLKYDLD
TIKHRISQLFPVEMRLKVKNGINNCTLIDDSYSSDFQSLKIALDFLENQKQHLKKTLILS
DIYQSGLENEDLYVRVSQLIISNKINRVICIGGVISKYKNKFLNVISYLSTNDFIEDFDN
LDFTNETILIKGSRHFEFEKIVTLLEEKTHETVLEINLNAISHNLNYFKSKLNPKTKIMV
MVKAFGYGSGSFEIAKLLAHHKVNYLGVAFADEGIELRQAGIQLPIMVLNPEMTSFPSII
QYNLEPEIYSIRGLKAFIKITQQKELTSYPIHIKINTGMNRLGFDAQIIPELISILQKHD
SVLVKSILSHLAASDDLAQDIFTRKQISDFDTISNKITTKLKINPIRHISNTSAISNYPQ
AQFDMVRLGIGLYGVSNDANETKKLENVGTLKSIISQIRNLNSGQSVGYNRRFMVKKPTT
IATIPIGYADGISRAWGNEVGYVLVNEQKAPIVGSICMDMLMIDVTKINCSEGNQVIIFG
KTPSVTTIAKATKTIPYEILTSISSRVKRVFYRE
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
ttgactatatccttacacaatataattcctattctagatgccaattttcagggtattgac
gataatatttactacgataatatctcgatagatagtcgttcgcttcaaaacaacgaaaac
actttgttttttgcactagttggtcctaataatgatgcccatatttatattggagattta
atctccaaaggtgttaaaaactttgtagttacctatattcctaaaagattaactggcaaa
gcaaattttttaattgtaaaaaatactcttgtagctttacaaatatttgcccgttattat
cgtaatttatttcattttccaatcataggaattacaggaagcaacggaaaaaccattgta
aaagaatggcttaatttcttattaagtcctgattataatataattagaagtcctaaaagc
tacaattcgcaagttggcgttcccctttctgtgattgcaattaatgaaaatcataattta
ggcatttttgaagccggaatttctaccaaagacgaaatggaaaatcttcaaaaaataata
cagccaaccattgggattttaaccaatatagggaccgctcatgatgaaggttttgctgat
atttctgagaaaataaaagaaaaactcaagctatttactgccgtagaagttttaattctt
aataagaataaaaccatcgaaacttttattaacaaagagattaatacttttacttggagt
acaaatgatcagtctgccgatgttttttttcagaaaaaaacactcaatgatcatgctctt
ttgaatattacaaatcaggggaaatattttaaaataaaaattccatttattgatgaagct
tcactagaaaacagcatgcattgcattttggtaatgttatatttgaagtatgatttagat
acaattaagcatcgtatttctcaattatttccagtcgaaatgcgattgaaggtaaaaaac
ggaattaacaattgtactttaattgatgatagttatagttctgattttcagtctttaaaa
atagctttagattttcttgaaaatcaaaaacaacacttaaaaaaaacactcattttatca
gatatttatcagtcaggattagaaaacgaagacttatatgttcgtgtttctcagcttatt
atttcaaacaaaataaatcgagtaatttgcattggaggtgtaatttctaaatataaaaac
aagtttctcaatgtcatttcttacctttcaacaaatgattttattgaagattttgacaat
ctagattttacaaacgaaactattttaataaaaggatctcgacatttcgaattcgaaaaa
attgtaaccttactcgaggaaaaaacacatgaaacagttttagaaattaaccttaatgcc
ataagccataatttaaattacttcaaatcgaaactaaatcccaaaaccaaaatcatggtt
atggtaaaagcttttggttacggaagtggctcatttgagattgccaaactcctcgcccac
cacaaagtaaattatcttggtgtggcattcgccgatgaaggaatcgaactccgccaagca
ggcattcaattacctatcatggttctaaatccagaaatgaccagtttcccatcgataatt
caatacaatttagaacccgaaatatatagtattcgaggtctgaaagcatttataaaaatt
acccaacaaaaagaacttaccagttatcctatacatattaagataaatacaggtatgaat
cgtttgggttttgatgcgcaaattattccagaactcatctcaatattacaaaagcatgat
tcagttttggtaaaaagtattttgtctcatttagcggcaagcgatgatttagcacaggat
atttttacccgaaaacaaatttcagattttgatacaatatctaataaaattaccacaaaa
ttaaaaataaatcctattcgccatatttcaaacacctctgcaataagcaattatccgcaa
gcgcagtttgatatggttcgattaggcattgggttatatggcgtttctaatgatgccaat
gaaacaaaaaaacttgaaaatgtagggacattaaaatcgataatttcacaaattcgcaat
ttaaacagtggccaaagcgtagggtataatagacggtttatggtaaaaaaacctactaca
attgctacaatcccaataggctatgccgacggaatttcacgtgcttggggaaatgaagtt
ggttatgttttagttaatgaacaaaaagcccccatcgtaggaagtatttgtatggatatg
ctaatgatagatgtcacaaaaattaattgttctgaaggtaatcaagtaattatctttggc
aagaccccatcagtaaccaccatcgcaaaagcaacaaaaacaataccttacgaaatatta
acaagtatttcaagcagggtaaaacgggttttttacagagaataa

DBGET integrated database retrieval system