KEGG   Flavobacterium psychrophilum FPG3: FPG3_12090Help
Entry
FPG3_12090        CDS       T03296                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fpo  Flavobacterium psychrophilum FPG3
Pathway
fpo00020  Citrate cycle (TCA cycle)
fpo00310  Lysine degradation
fpo00380  Tryptophan metabolism
fpo01100  Metabolic pathways
fpo01110  Biosynthesis of secondary metabolites
fpo01120  Microbial metabolism in diverse environments
fpo01130  Biosynthesis of antibiotics
fpo01200  Carbon metabolism
Module
fpo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fpo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FPG3_12090
  Amino acid metabolism
   00310 Lysine degradation
    FPG3_12090
   00380 Tryptophan metabolism
    FPG3_12090
Enzymes [BR:fpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     FPG3_12090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PhaC_N
Motif
Other DBs
NCBI-ProteinID: AIN74957
LinkDB All DBs
Position
2624730..2627501
Genome map
AA seq 923 aa AA seqDB search
MDRFSFLNAAHTEFFAQLYDQYLENPDSIEPSWRSFFQGFDFGMTTYSEENAANQMANIA
TTNVDNGQVSDKILKEFNVLKLIDGYRTRGHLFTQTNPVRERRHYTPTLELSDFGLTDSD
LNTVFDAAKIIGHQPSTLQEIIIHLKNVYCQHIGIEYMYMRNPEIIQWVQNKINTNDNQP
NFDNNQKKIILEKLNEAVSFENFLHTKYVGQKRFSLEGGETIIAGLDALIEAAADKGVEK
FVMGMAHRGRLNVLANIFKKSTQDIFSEFDGKDYDQEYFDGDVKYHLGLTSDRKTRSGKN
ININLAPNPSHLETVGAVIEGITRAKQDKYFPNDFSKVLPIAVHGDAAIAGQGILYEIIQ
MAQLDGYKTGGTIHIVINNQVGFTTNYLDARSSTYCTDIAKVTLSPVLHVNADDAEAVVH
AMLFALDFRMQFGRDVFIDLLGYRKYGHNEGDEPRFTQPLLYKIIAKHKNPRDIYAEKLL
AQNIIDGNFVKELETSYKQDLDDNLEASRKKSLTVITPFMQNEWEGFVQVSDDVMLQKVN
TKFDKKELDSIIETISTLPSDKKFINKISKIVNDRKTMYDNNTIDWGTAETLAYGSLLTE
GYDVRISGQDVERGTFSHRHAVVKVEDSEEEVVLLNDIKGKKGNFNVFNSHLSEYGVLGF
DYGYALANPNALTIWEAQFGDFSNGAQIMIDQYISCGEDKWNNQNGIVMLLPHGYEGQGA
EHSSGRMERYLQLCARHNMVVADCTTPANFFHLLRRQMLTKYRKPLIVFTPKSLLRDPRC
VSTQDEIANGEFQETIDDISVNKTQVKTLVFCTGKFYYDITAERENLQRNDVAVVRIEQM
FPLPVEQLKAIVASYPNADDYVWAQEEPKNMGAYSFMLMNFDFIKWRLASLKAYAAPAAG
SYTRAKRRHADAIRMVFDKDLFR
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggataggttttcatttttaaacgcagctcacacagaatttttcgcacaattatacgac
caatatctcgaaaatccagatagtatcgagccttcttggaggagtttctttcagggtttc
gattttggaatgacaacttatagcgaagaaaacgcagcaaatcagatggcgaatatcgct
acaacaaatgtagataacggtcaagtttcagataaaattctaaaagaatttaatgtattg
aaactaatagatggttatagaactcgtgggcatttatttacccaaaccaaccctgttcgt
gagcgaagacattacacgccaacattagaactgtcagattttggtcttaccgattccgat
ttgaatactgtcttcgatgcagcaaaaataattggacaccagccatcaaccttacaagaa
ataattattcacctcaaaaacgtatattgccaacatattggtatcgaatatatgtatatg
agaaatcctgaaatcattcaatgggttcagaacaaaataaacacaaacgacaatcagcct
aattttgataacaatcagaaaaaaattatcctcgaaaaactaaatgaagctgtttcgttc
gaaaactttttacatactaaatatgtaggtcaaaaacgattttcattagaaggaggagaa
actataattgctggtttagacgctcttatagaagccgccgctgataaaggtgtcgaaaaa
tttgtaatgggaatggcacaccgtggccgtttaaacgttttagcaaatatttttaaaaaa
tcaacacaagatatcttctcggaatttgacggaaaagattacgaccaagaatatttcgat
ggtgatgtaaaataccatttgggtttaacctccgataggaaaacacgatcaggaaaaaac
atcaatatcaatttagccccaaacccttcacacctagaaactgttggagctgttattgaa
ggaattactcgtgccaaacaagacaaatattttcctaacgatttctcgaaagtattgcct
atcgccgttcacggtgatgccgcaattgcaggacaaggaatcctatacgaaattatccag
atggcacaactagacggttacaaaactggcggaactattcatatagtgattaacaatcaa
gttggttttacaactaattatcttgatgcacgctcatcaacttattgtaccgatattgca
aaagtaacactatcaccagtattacacgtaaatgcagatgatgccgaagctgttgtacac
gccatgctttttgctctagatttcagaatgcaatttggtcgtgacgtatttatagattta
ttaggatacagaaaatatggtcataacgaaggcgacgaacctcgttttacacaaccatta
ttatacaaaatcattgcaaaacacaaaaacccacgtgatatttatgccgaaaaattatta
gcacaaaacatcatcgatggcaattttgtaaaagaattagaaacatcatacaaacaagat
ttagatgataatctagaagcatcacgtaaaaaatcactcacagtaatcacgccatttatg
caaaatgaatgggaaggatttgtgcaggtttcagatgacgtaatgcttcaaaaagtaaat
acaaaatttgataaaaaagaattagattctatcatagaaaccatttcgacattgccatcg
gacaagaaatttatcaataaaatttctaaaattgtcaatgacagaaaaacgatgtacgac
aacaacaccatcgactggggaactgccgaaaccttggcctatggttcgctactaacagaa
ggttacgatgttcgtatctcaggacaagatgtagaaagaggaacattctcacaccgtcac
gccgttgtaaaagtagaagatagcgaagaagaagttgttttattaaacgatataaaaggg
aaaaaaggaaacttcaatgttttcaattcacacctttcagaatacggagtcttaggattc
gattacggatatgcactagcaaacccaaatgctttaaccatttgggaagcacaatttggc
gatttcagtaatggagcccaaattatgatagaccaatacatttcgtgcggagaagacaaa
tggaacaaccaaaacggtatcgtaatgttgttgcctcacggatacgaaggccaaggagca
gaacactcctcaggaagaatggaacgctacttacaactttgtgcacgccataatatggtt
gttgccgattgtacaacacccgccaatttcttccacctactaagaagacaaatgcttaca
aaataccgcaaaccattaattgtgtttaccccaaaaagtttgcttcgtgatcctagatgt
gtctctacacaagacgaaatcgcaaatggtgagtttcaagaaactatcgatgatatttca
gtaaataaaacccaggttaaaacattagttttctgtacaggaaaattctattacgacatt
actgccgaaagagaaaacctacaaagaaacgatgttgcagtggtaagaatcgaacaaatg
ttcccgttaccagtagaacaattaaaagcaattgtggcaagctatccaaatgcagatgat
tatgtttgggcacaagaagaacctaaaaacatgggagcttatagttttatgctaatgaat
ttcgatttcataaaatggagattggcatcgttaaaagcatacgccgcaccagcagcagga
agttataccagagcaaaacgccgtcacgccgatgcaattagaatggttttcgacaaagat
ttgtttagataa

DBGET integrated database retrieval system